KEGG   Candidatus Koribacter versatilis: Acid345_3256Help
Entry
Acid345_3256      CDS       T00352                                 

Definition
magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Acid345_3256
Enzymes [BR:aba01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Acid345_3256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3856749..3858257
Genome map
AA seq 502 aa AA seqDB search
MSSLPETLGQLRKSSFSEPRLARRRVKDELRENLLDRLRQGGNIFPGIVGYEDTVTPQVV
NALLSRHNFILLGLRGQAKSRILRALTSLLDAETPYLAGCEIHDNPYDPICRRCKDMIKS
FGDDAPIAWLSAEERYVEKLATPDVTIADLIGDIDPIKAAKQGFTLASELTVHYGLLPRA
NRGIFAINELPDLAGKIQVGLFNIMQEGDVQIKGYPIRLPLDVALVFSANPEDYTARGKI
ITPLKDRIGSEIRTHYPSTVEEGISITQQEAWTRRDGTRIHIPSYIHEIVEQIAFVARDD
KRVDKRSGVSQRLPISTVENVLSNAERRALRSGEHTVVPRVADIYAALPAITGKLELEYE
GEIKGADAIAREVIRTAIAKTYDRYFQGNNNHLKQVVQYFDLGGEVQMLDTAPAEEVLES
MKNIQGLMEKIENVGAKTSDAPELQASAAEFILEGLHAHKRIGRTEERKFTAGEKQSAKK
EQLFREEDDFVRERNRRNRGFN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
ttgagttcccttcccgaaacactcggccaactgagaaagtcttcattttccgaaccgcgt
ctggcgagacgccgcgtgaaagacgagctgcgcgaaaacctgctcgaccgcctgcggcaa
gggggaaacatcttccctgggatcgtgggctacgaagacacggtgacgccgcaagtcgtg
aatgcgctgctctcgcggcataacttcatcctgctcggactgcgcggacaggcgaagagc
cgcatactgcgcgcgcttacgtcgctgctcgacgcggagacgccgtatctcgcgggctgc
gagatccatgacaatccgtacgatccgatctgccggcgctgcaaggacatgatcaaatcg
tttggcgacgatgcgccaatcgcgtggctttccgccgaggaacgctacgtggagaagctg
gcgacgccggacgtgacgatcgcggacctcattggcgatatcgatccgatcaaagcggcg
aagcagggatttacgctggcgagcgaattgacggtccactacggtctgttgccgcgcgcc
aatcgcgggatctttgcgattaatgagttgccggatttggcggggaaaatccaggtgggg
ttgttcaacatcatgcaggaaggcgatgtgcagattaagggctacccgatccggctgccg
ctggatgtggcgctcgtctttagcgcgaacccggaggactacaccgcgcgcggcaagatc
attacgccgctgaaggaccgcatcgggtcggagattcgcacgcactatccgtcgacggtg
gaagaagggatttcgatcacgcagcaggaggcgtggacgcggcgggatggtacgcgcatc
catatcccgagctacattcacgagatcgtggaacaaattgcgttcgtggcgcgcgatgat
aagcgggtggataagcgctcgggcgtgagccagcggctgccgatctcgaccgtggagaat
gttctttcgaacgccgagcggcgagcgctgcggagtggtgagcatacggtggtgccgcgg
gtggcggatatctacgcggcgctgccggcaattaccggcaagctggaactggaatacgaa
ggcgagatcaaaggcgcggatgcgattgcgcgagaggtcatccgcacggcgattgcgaag
acttacgatcgatacttccagggaaacaacaaccatctgaagcaggtggtgcagtacttc
gacctcggcggcgaagtgcagatgctcgacacggccccggcagaagaagtgctggagagc
atgaagaacatccagggactgatggagaagattgagaacgtgggcgcaaagacgagcgat
gcgccagagctgcaggcgtcggcagcggagttcattctagaaggcctgcacgcgcataag
cgcatcggccgcacggaggaacgtaagttcactgctggagagaagcagagtgcgaagaaa
gagcagctcttccgcgaggaagacgatttcgttcgcgagcgcaaccggagaaaccgcggg
ttcaactag

DBGET integrated database retrieval system