KEGG   Candidatus Koribacter versatilis: Acid345_3493Help
Entry
Acid345_3493      CDS       T00352                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Acid345_3493
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Acid345_3493
Enzymes [BR:aba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Acid345_3493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4119937..4121988
Genome map
AA seq 683 aa AA seqDB search
MRNLLLSVIAALMFMPFAFSQNQNVPNLMPLPKSIQYQSGQLTIDSSFSTAITGHNEERL
QRALARMTTTLGRQTGLTINGKSGDAANATLVIHADQASEEVQKVGEDESYDLTVTAKGA
NLKAANPLGILRGLQTFLQLVELTPKGYAVPAVTIKDEPRFPWRGLMIDVSRHWQPIEVI
KRNLDGMEAVKLNTFHWHLSDNQGVRVESKKFPKLQEMGSDGHFFSQEEVKDVIAYGRDR
GIRVIPEFDWPGHSTAFFVGHPELASGSGPYSIEREFGIFDPALDPTKESTYKFLDAFIG
EMAALFPDPYFHIGGDEVNGKEWDRNPKIQEYMKAHGIKNNDELQATFTKRVQEIVAKHH
KTMVGWDEILSPEIPKSIVIQSWRGPVSLAAAAKQGYKGLLSFGFYLDLFQPASFHYLNE
PISGKAAELNDEEKKMILGGEACMWSELVTPDTIDSRIWPRMAAIAERLWSPQNTRDVRS
MYTRMEAESMRLEWLGLKHRSYYQPALERLVESNDIAAIKTLADVVSAPQEYGREGVHVA
QTGHVYRSTESYNRLVDATKPESITAVEFGFMVDDLLAKKATPAEIEKMKTMLTAWRDND
PKLQPQLQASFLLKEAVPLSQTLSATANSGLMALEYLQNGSKPAPGWASQQMAAIDAGKK
AQGELLVAIAPAVQKLVKAAGAQ
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaccttcttctgagcgttattgccgcactcatgtttatgccgtttgccttctcc
caaaaccaaaatgtccccaacctgatgccgcttccgaagagcattcagtatcaaagcgga
cagctgacgattgactcgtcgttttcgacggcgatcaccggacacaacgaagagcgcttg
cagcgcgcattggcgcgtatgacgacgacgctcggccggcagacggggctgacgatcaat
ggcaagagtggcgatgcggcgaacgcgacgctggtgatccatgcggaccaggcgagtgaa
gaagtacagaaggtcggcgaagacgaatcgtacgacctcacggtcactgcgaagggcgcg
aacctgaaagcagcaaatccgttggggattctgcgtggtttgcaaacgtttctgcaactc
gtcgagttgacgcccaagggctacgcggtgccggcggtgacgatcaaagacgagccgcga
ttcccgtggcgcggactgatgatcgatgtgagccgtcattggcagccgatcgaggtaatc
aagcggaacctcgatggcatggaggcggtgaagctcaacaccttccattggcatctctcg
gacaaccagggcgttcgcgtggagagcaagaagtttcccaagctgcaggagatgggctcg
gacggtcacttcttctcgcaggaagaagtgaaagacgtaattgcgtatggtcgcgatcgc
gggattcgcgtaattccggaattcgattggccgggacatagcaccgcgttcttcgtgggg
catccggaactggcgagcgggtcggggccgtattcgattgaacgcgagtttggaatcttc
gatccggcactcgatccgacaaaagaatctacctacaaattcctggacgcgtttatcgga
gagatggcagcgctcttccctgacccgtattttcacatcggcggcgacgaggtgaacggc
aaggagtgggaccgcaatccgaagatccaggagtacatgaaggcgcacggcatcaagaac
aatgatgagttgcaggcgaccttcaccaagcgggtacaggaaatcgtcgccaagcaccac
aagacgatggtgggctgggacgagattctctcgccagagatcccgaaatccatcgtgatc
cagtcgtggcggggacccgtgtcactggcggcagcggcaaagcaaggctacaaagggctg
ctctcgttcggcttctacctcgatttgttccagccggcgtcgttccactacttgaatgaa
ccaatttccggcaaagcagcggaactcaacgacgaggaaaagaagatgatcctcggtggc
gaggcctgtatgtggtcggagctggtaacgccagacacgattgattcgcgcatctggccg
cgcatggctgcgattgcggagcggctctggtcgccgcagaacactcgcgatgtccgctcg
atgtacacgcgcatggaagcggagtcaatgcggttggagtggctgggcctgaagcatcgt
tcgtactaccagccagcgctggagcgcctcgtggaatcgaatgacattgctgcgatcaag
actctggccgatgtcgtctcggcaccgcaggaatacggacgcgaaggagtgcatgtcgca
cagaccggacatgtgtaccggagcacggaatcctacaaccggctggtggatgcgacgaag
ccggagagcatcacggcagtggaattcggcttcatggtagatgacttgctcgccaagaaa
gccacgccggcggaaattgaaaagatgaagacgatgctgacggcatggcgagacaatgat
cccaagctgcagccgcagttgcaggcatcattcttattaaaggaagcggtaccgctgtca
cagacgctgtcggcgacggcgaactcagggctaatggcgctggagtatctgcagaacgga
agcaagccggcaccagggtgggcgagtcagcaaatggctgcgattgacgcaggcaaaaaa
gcgcagggcgaattgctcgtcgcgattgcacctgcggtacagaaactggtgaaggccgcc
ggggctcagtag

DBGET integrated database retrieval system