KEGG   Candidatus Koribacter versatilis: Acid345_3683Help
Entry
Acid345_3683      CDS       T00352                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aba01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:aba00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4357135..4358382
Genome map
AA seq 415 aa AA seqDB search
MRILRLEKSSGLLAKLAARGMADASRVEPVVRKIVVDVRKNGDAALRRYASKLDGLGKTA
ALRVSTEELKSAWDATRSEFKQAIRAAAKNIERFARWQMPKSWTRDAGDGIELGQIIRPI
ESVGCYVPGGRYPLPSTVLMTVVPARVAGVERVVVVSPNPARETLAAAYLLGVGEFYRIG
GAQAVAALAYGTESVERVAKIVGPGNIFVTTAKKLVAFDCAIDMLAGPTEAAIVSERGNA
RFIAADLVAQAEHDPETMVAFFTTSPSLADAVKKQVALLAAKNTIARKALATRGYIFVAQ
DIAQAMEAANQFASEHLTVDEDLLETVSSAGSVFVGDYSAQSFGDYASGPNHVLPTGGLA
RVRGGLSVLDYVKIITVQKISRKGLRALAPIAETLAAAEGLVAHGQSVAIRRANA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcctgcgactggagaaatccagtgggttgctggcgaagctcgcggcacgagga
atggcggacgcttcacgagtggaaccagtagtccggaagatcgttgtcgatgtacgaaag
aacggcgacgccgcgctacgacggtacgcgagcaagttggatggactcggaaagactgcg
gcgttgcgagtgtcgacggaagagttgaagtctgcgtgggatgcgacccgcagtgaattt
aaacaagcgatcagggccgctgcgaagaacatcgagcgcttcgcgcgctggcagatgccg
aaatcgtggacgcgtgacgcgggcgatggcattgagcttggacaaatcattcggccaatc
gaatcggtggggtgctacgttccgggcgggcggtatccgctgccctcaaccgtgctgatg
acggtggttccagcgcgggtggcgggggtggagagggtcgttgtggtatcgccgaacccg
gcacgagagacgctggcagctgcgtacctcttgggcgttggggagttctaccggatcggc
ggcgcgcaggctgtggcggcgctggcgtacggaactgagtcagtcgagcgggttgcgaag
atcgtgggccccggaaacatcttcgtgaccacagcgaaaaagttggtggccttcgattgt
gcgatcgacatgctagcaggccctacagaagccgcgatcgtgagtgagcgcgggaatgcg
cgctttatcgctgctgatcttgtggcgcaggcagaacatgatcccgagaccatggtggcg
ttctttacgacgtctccctcgctggcggacgcggtgaaaaagcaagtggcgctactggca
gcaaagaacacgattgcgcgaaaagcgcttgcgactcgcggttacattttcgtcgcgcag
gatattgcgcaagcgatggaggccgcgaaccaattcgcttcggagcacttgacggtcgat
gaagatcttctcgaaaccgtatccagcgcgggatcggtgttcgtgggagactactcggcg
caatcgttcggtgactacgcgagtgggccgaaccatgtgctgccgacaggcgggctggcg
cgagtgcgtggcggtttgagcgtgctcgactacgtgaaaatcatcacggtgcaaaagatt
tcgcgaaagggactgcgcgcgctcgcgcccatcgctgagacgctcgcagctgcggagggt
ctcgtcgcgcacgggcaatcggtggcgattcggagggcgaatgcttaa

DBGET integrated database retrieval system