KEGG   Candidatus Koribacter versatilis: Acid345_3866Help
Entry
Acid345_3866      CDS       T00352                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:aba00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Acid345_3866
Enzymes [BR:aba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Acid345_3866
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Acid345_3866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4577747..4578565)
Genome map
AA seq 272 aa AA seqDB search
MPELPEVETVANGLNKRAAGTTIESVWIGEKKQPLKSSARAIAKMLEGAKITLVRRVGKH
IVADLAEPDGEPRGQWIIHLGMTGSTLVVDPDTPLPKHTHLIAKLSSGKELRFVDPRMFG
KLAVRAKSDVFAAPGLEPLTVSLEDFQKLFRGRNTPIKSALLNQALLSGVGNIYADEALF
RAGIRPRRRAKSLSRADLTRLHEKVGEVLREAVELGGSSVNDYVDAEGNEGFFQLRHNVY
QRTGEPCFTCKKPIKRVVIAGRSSHYCQNCQK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaacttcccgaggtagaaaccgtagccaacggcctgaacaagcgcgccgccggc
acgaccatagaatccgtctggatcggcgagaagaagcagccgctcaagtccagcgcccgc
gccattgccaaaatgctcgaaggcgcgaagatcacgctcgtccgccgcgtcggcaaacat
atcgtggccgacctcgctgagcccgacggggaaccgcgcggccagtggatcatccacctc
ggcatgaccggcagcaccctggtcgttgatcccgatacgccgcttcccaagcacacccac
ctgatcgccaagctgtcgtcggggaaagaactgcgcttcgtggacccgcgcatgttcggc
aagctcgccgtccgtgcgaaatccgacgttttcgccgctcccggcctggagccgctgacc
gtctcgctggaggatttccaaaagctcttccgcgggaggaacacgccgatcaagagtgcc
ttgttgaaccaagccctgttaagcggggtgggcaacatctacgccgatgaggcactcttt
cgtgccggtatccgcccgcgccgacgcgccaagtcgctcagtcgcgccgacctcacgcgg
ctccacgaaaaagtcggcgaagtgttacgcgaggccgtggaacttggcggttcgtcagtt
aatgattatgttgacgcagaaggcaacgagggtttttttcaattgcgtcataacgtttac
cagcgcactggggagccctgtttcacctgtaagaagccgattaaacgggtggtcatagcg
ggaagaagcagccattactgtcaaaattgccagaaatag

DBGET integrated database retrieval system