KEGG   Candidatus Koribacter versatilis: Acid345_3950Help
Entry
Acid345_3950      CDS       T00352                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aba00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:aba00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:aba02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4672498..4674567
Genome map
AA seq 689 aa AA seqDB search
MTFNRREFLAMAAVLGANAAWGRGLGSPSSVAWQERRDFYPEGVASGDPDSNSVLLWTRH
LPGSSPVEELTVEVALDESFRKVIAKHTAKVSPAADWTCRVLVGGLNPGHVYWYRFTDHN
GFGSRIGRTMTAPSDDDPRPVRFAFVSCQNANLGAQNAYRRMIFEDERADEANRLGFVLH
LGDFIYELVWYPEDKATYYDRQVQDIVRYPKGEKVSNFHIPVDVDDYRAVYRSYLHDPDL
QDARARFPFVPMWDNHEFSWQGWQSFEVFDGKTRPAQTRKVAAMQAFFEYQPARMAKPSG
PSLEQFNPPTVADVAVTKFDDNGLGQEPNNLAAINSLKGYRSLRWGKHVELIITDERSYR
SPDPGTDLDGDALFNKDFSEFIPEEVMEIIDAGREYNGGKPPDAIPFGDKKVANTQKNRP
PQTILGAEQKKWFFDQLRESKATWKIWGSTTATLPQRADPQNLPPGITSSKWPGEAYASM
GGADMSTASHELGQIYDFVRQHEITGFAAVAGDRHSFWAGLASKSLPPKPFDPVGVAFVV
GSISSPGGLEAYEHKMAKDEPLRSLFIGQAPADTKPQPTINMLLMHGVRSCLEYCKSGDL
AKARALSNPSMAPQMSFVDIGGHGYAVVQAAANELETEFVCIPRPVRRIDSPDGGPILYR
ARNHSRLWRAGEPPKLESTVVEGEARFSV
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgactttcaatcggcgcgagtttctcgccatggctgcggtgctgggtgcgaacgcagca
tggggacgcggattaggttcaccatcgagcgttgcgtggcaggagcggcgcgatttctac
ccggaaggtgtcgcgtcgggtgatcctgatagcaatagcgttctgctgtggacgcggcat
ctgcccggcagttcaccggttgaagaactgactgtcgaagtagcacttgatgaatcgttc
cgtaaagtgatcgccaagcacaccgccaaggtctcaccagcagccgactggacttgtcgt
gtactggtaggcggtctgaacccgggacacgtttattggtacagatttaccgaccacaac
ggcttcggcagtcgaatcggtcgaaccatgacggcgccgagcgacgacgatccgcgcccg
gtgagattcgcgtttgtgagttgccagaacgccaaccttggtgctcagaacgcttaccgc
cgcatgatttttgaagacgagcgagccgacgaagccaaccgcctcgggtttgtgcttcac
ctcggtgacttcatctacgaactcgtttggtatccggaagacaaggccacctattacgat
cgccaggtccaggacatcgttcgctacccgaaaggtgaaaaggtcagcaactttcatatt
cctgtggatgtagatgactatcgcgctgtctaccgcagctacctgcacgatcccgatctc
caggacgcgcgcgcgcgatttccgtttgttcccatgtgggacaaccacgagttcagttgg
caaggatggcaaagcttcgaggtgttcgacggaaaaacgagaccggcgcagacgcgcaag
gtagcggccatgcaggcgttcttcgagtatcagccggcgcgaatggcgaagcccagcggt
ccttcgctcgaacagttcaatccgccgaccgtcgctgatgtcgcagtgacgaaattcgac
gacaacggtctcggacaagaaccgaataacctcgcagccatcaacagccttaagggctac
aggtcgttgcgctgggggaagcatgtcgaattgatcatcaccgacgaacgaagctaccgt
tcgccggaccccggaaccgacctcgacggcgatgcgctgttcaacaaggatttctccgag
ttcattccggaagaagtcatggagatcattgacgctggtcgcgaatataacggcggcaaa
cctccggacgcgattccctttggcgataagaaggtcgcgaacacgcaaaagaaccgcccg
ccccagaccattctcggcgcagagcagaaaaagtggttttttgatcagttgcgagaatcg
aaggcgacctggaagatttggggaagcactacggccacgcttccgcagcgggcagatccg
caaaacctgccgccaggcattacctccagtaaatggcccggcgaagcgtatgcgagcatg
ggcggcgccgatatgagcacggcctcccacgaactaggccaaatctatgacttcgtccgg
cagcatgaaatcacaggcttcgctgccgtcgcgggcgacaggcacagcttctgggcaggg
ttagcttcgaaatctcttcccccaaaaccattcgatcccgtcggcgtggcatttgtcgtg
ggttccatttcgtctcccggcggtttggaagcttatgaacacaaaatggcaaaagacgag
cccttgcgctcactctttataggtcaagcccccgcagacaccaagccgcagccgaccatc
aacatgctcttaatgcacggcgttcgctcctgcctcgaatactgcaagagcggtgacctc
gcgaaagcacgcgcactctcaaatcccagcatggcgccgcagatgtcgttcgtcgacatc
ggcggacacggctatgcggtcgtccaggccgcagcgaatgagctcgaaacagaattcgtt
tgcattccgcgcccggtgcgtcgcattgacagcccggatggaggtccaatcctctaccgc
gcgcgtaaccatagccggctgtggcgagcgggcgagccgccaaagctagagagcacagtg
gtggaaggagaagcacgattttcggtttga

DBGET integrated database retrieval system