KEGG   Candidatus Koribacter versatilis: Acid345_4086Help
Entry
Acid345_4086      CDS       T00352                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00010  Glycolysis / Gluconeogenesis
aba00030  Pentose phosphate pathway
aba00051  Fructose and mannose metabolism
aba00052  Galactose metabolism
aba00680  Methane metabolism
aba01100  Metabolic pathways
aba01110  Biosynthesis of secondary metabolites
aba01120  Microbial metabolism in diverse environments
aba01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acid345_4086
   00030 Pentose phosphate pathway
    Acid345_4086
   00051 Fructose and mannose metabolism
    Acid345_4086
   00052 Galactose metabolism
    Acid345_4086
  Energy metabolism
   00680 Methane metabolism
    Acid345_4086
Enzymes [BR:aba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Acid345_4086
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Acid345_4086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABF43086
JGI: Acid3454086
UniProt: Q1IJ64
Position
4840666..4841772
Genome map
AA seq 368 aa AA seqDB search
MSDIKKIAINTGGGDAPGLNAVIHGAVYAARRLGWEVFGIRDGYDGILEPHRYPNGGLIQ
LNRGVVRDISHVGGTILGTTNRGNPFRRVITAADGTKHETDCSDQILNFFRDRGIDALIS
IGGDGSLTIANGLAKKGLRVVGVPKTIDNDLESTAMTFGFNTAVSFATECIDRLHSTALS
HQRILVVEVMGRYAGWIALHCGVAGRADAILIPEIPYKIENVANALKLRHQDGKPYSIVV
VAEGAKAHGKDVTIREREVGKAERLGGIGEQVTQQLQSLTGKESRTVVLGHLLRGGSPTA
LDRNLGVTFGAGAVEALAEGRSTVMVALHPPHLAFVPLEEAIAKLRLVPPDSDLVLTARA
IGIAFGDE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcaagaagattgcaatcaatacgggcgggggcgatgctcccgggttgaac
gccgtcatccacggcgcggtgtatgctgcgcgccgcctcggctgggaagtgttcggcatt
cgcgacggctacgacggcattcttgaaccacatcgctatcccaatggtgggctgatccag
ctgaaccgtggtgttgtgcgcgacatctcccacgtcggcggcacgatcctcgggaccact
aaccgcggcaaccccttccgccgcgtcatcaccgccgccgatggcacgaagcacgaaacc
gattgctccgatcagatcctcaacttcttccgcgatcgcggcatcgacgccctgatttcc
attggcggcgacggcagcctcaccatcgccaacggcctcgccaagaaaggtctgcgcgtc
gttggcgttccaaagaccatcgacaacgatctcgaatccacagcaatgaccttcggcttc
aataccgccgtctccttcgccaccgaatgtattgaccgcctgcacagcaccgcgctctcc
caccagcgcatcctggtcgtcgaagtaatgggccgctacgccggttggatcgccctgcac
tgcggtgtcgccggacgcgccgatgccatcctcatccctgagatcccctacaaaatcgaa
aacgtggcgaacgccctcaaactccgacaccaggacggcaagccgtactccatcgtcgta
gtcgcggaaggcgccaaagctcacggcaaggatgtcaccataagggagcgcgaagtcggc
aaagccgagcgcctcggtggcatcggcgagcaggtcacgcaacaattacaaagcctcacc
ggcaaagagagtcgcaccgttgtcctcggtcacctcctacgcggtggatcgccgacggca
ctcgaccgcaatttaggagtcaccttcggtgccggcgccgtcgaagccctcgccgaaggc
cgcagcaccgtgatggtcgcgctccatccgccgcatctagccttcgtcccgctcgaagag
gccatcgcgaaactccgcctcgttcctccggacagcgatttggtcctgaccgcgcgcgcc
attggcatcgccttcggagatgaataa

DBGET integrated database retrieval system