KEGG   Candidatus Koribacter versatilis: Acid345_4086Help
Entry
Acid345_4086      CDS       T00352                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acid345_4086
   01230 Biosynthesis of amino acids
    Acid345_4086
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acid345_4086
   00030 Pentose phosphate pathway
    Acid345_4086
   00051 Fructose and mannose metabolism
    Acid345_4086
   00052 Galactose metabolism
    Acid345_4086
  Energy metabolism
   00680 Methane metabolism
    Acid345_4086
Enzymes [BR:aba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Acid345_4086
Protein phosphatases and associated proteins [BR:aba01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Acid345_4086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4840666..4841772
Genome map
AA seq 368 aa AA seqDB search
MSDIKKIAINTGGGDAPGLNAVIHGAVYAARRLGWEVFGIRDGYDGILEPHRYPNGGLIQ
LNRGVVRDISHVGGTILGTTNRGNPFRRVITAADGTKHETDCSDQILNFFRDRGIDALIS
IGGDGSLTIANGLAKKGLRVVGVPKTIDNDLESTAMTFGFNTAVSFATECIDRLHSTALS
HQRILVVEVMGRYAGWIALHCGVAGRADAILIPEIPYKIENVANALKLRHQDGKPYSIVV
VAEGAKAHGKDVTIREREVGKAERLGGIGEQVTQQLQSLTGKESRTVVLGHLLRGGSPTA
LDRNLGVTFGAGAVEALAEGRSTVMVALHPPHLAFVPLEEAIAKLRLVPPDSDLVLTARA
IGIAFGDE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcaagaagattgcaatcaatacgggcgggggcgatgctcccgggttgaac
gccgtcatccacggcgcggtgtatgctgcgcgccgcctcggctgggaagtgttcggcatt
cgcgacggctacgacggcattcttgaaccacatcgctatcccaatggtgggctgatccag
ctgaaccgtggtgttgtgcgcgacatctcccacgtcggcggcacgatcctcgggaccact
aaccgcggcaaccccttccgccgcgtcatcaccgccgccgatggcacgaagcacgaaacc
gattgctccgatcagatcctcaacttcttccgcgatcgcggcatcgacgccctgatttcc
attggcggcgacggcagcctcaccatcgccaacggcctcgccaagaaaggtctgcgcgtc
gttggcgttccaaagaccatcgacaacgatctcgaatccacagcaatgaccttcggcttc
aataccgccgtctccttcgccaccgaatgtattgaccgcctgcacagcaccgcgctctcc
caccagcgcatcctggtcgtcgaagtaatgggccgctacgccggttggatcgccctgcac
tgcggtgtcgccggacgcgccgatgccatcctcatccctgagatcccctacaaaatcgaa
aacgtggcgaacgccctcaaactccgacaccaggacggcaagccgtactccatcgtcgta
gtcgcggaaggcgccaaagctcacggcaaggatgtcaccataagggagcgcgaagtcggc
aaagccgagcgcctcggtggcatcggcgagcaggtcacgcaacaattacaaagcctcacc
ggcaaagagagtcgcaccgttgtcctcggtcacctcctacgcggtggatcgccgacggca
ctcgaccgcaatttaggagtcaccttcggtgccggcgccgtcgaagccctcgccgaaggc
cgcagcaccgtgatggtcgcgctccatccgccgcatctagccttcgtcccgctcgaagag
gccatcgcgaaactccgcctcgttcctccggacagcgatttggtcctgaccgcgcgcgcc
attggcatcgccttcggagatgaataa

DBGET integrated database retrieval system