KEGG   Candidatus Koribacter versatilis: Acid345_4153Help
Entry
Acid345_4153      CDS       T00352                                 

Definition
glucosylceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Acid345_4153
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Acid345_4153
Enzymes [BR:aba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Acid345_4153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4914457..4915875)
Genome map
AA seq 472 aa AA seqDB search
MTRLTFILALLVSLSAVHAQQVSVIETDADLHTPMQAKPALKFSPGPSSSSTTLTVSAAK
KYQTIDGFGASLTDSSAWLLYTKLTPEQRKQTMTDLFDPKQGIGLNFVRQPMGASDLALT
KYSYDDLPRGQTDPSLAHFSIAHDEPYILPTLREAIAINPELKIMATPWSPPGWMKTTDS
LIGGELRKDSYAPLAQYFVKFIQAYEKAGVPIYALTMQNEALFQPRNYSGMLFPAEDQRN
FLRDNLGPALAAATLHPKIMVYDHNWDHPEYPETILRDPVAAKYAAGIAWHCYGGDVSTQ
SRVHDEFPDKDAWETECSGGTWQKEKPLHAEAWLIIQSTRHWAKAVELWNMALDQKNGPF
VGGCDTCRGVVTVDTSKSPAVVTKNGDYYALGHASKFVRPGAHHIDTNDLENQKLLNVAF
QNPDGGIALLVLNFADAAQTFSVVGSGSSFMYTLPAGSLATFTWQPSTATPN
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcctcactttcatactcgccctacttgtgtctctctctgccgtgcacgcgcag
caggtgtccgtcattgaaactgacgccgacctccatacgcccatgcaggcgaaacccgca
ctcaaattttcaccgggcccaagttcctccagcacaaccctcacggtgagtgccgcgaag
aagtatcagaccatcgatggcttcggcgcgtcgctcaccgattcttccgcctggctcctc
tacaccaagctcacgcctgaacagcgcaagcagaccatgaccgacctcttcgatccgaag
cagggaatcggcctcaacttcgtgcgccagcccatgggcgcctccgatctcgcgctcacg
aaatactcgtacgacgatcttccccggggccagaccgacccgtcgctcgcgcacttctcc
atcgcgcacgacgagccctacatcctcccgacgttgcgcgaagccatcgccatcaatccc
gaactaaaaatcatggccacgccctggtctccgcccggatggatgaagaccaccgactcc
ctcatcggtggcgaactccgcaaagattcctacgccccgctcgcgcaatacttcgtcaag
ttcatccaggcctacgaaaaggccggcgtcccgatctacgcgctcaccatgcagaacgag
gccctcttccagcccaggaactattcgggcatgctctttcccgccgaagatcagcgcaac
ttcctgcgcgataacctcggccctgcgctagccgctgcgactctccatcccaagatcatg
gtctacgaccacaactgggaccacccggaatatcccgagacgatccttcgcgatccggtc
gctgcgaaatacgctgccggcatcgcctggcactgctacggtggtgacgtctccacgcag
tcccgagtccacgacgaattccccgacaaggacgcgtgggaaaccgagtgttccggcggc
acctggcagaaagaaaagccgctccacgccgaagcctggctcatcatccagtccacccgc
cactgggccaaggccgtcgaactttggaacatggcgcttgaccagaagaacggtccgttt
gtcggcggatgcgatacctgccgcggcgtcgtcaccgttgacaccagcaaatctcccgcg
gtcgtcaccaagaacggcgactactacgccctcggccacgccagcaaattcgttcgcccc
ggcgcgcaccacatcgacaccaacgatctcgaaaaccagaagctgctcaacgtcgcattt
cagaatcccgacggcggcatcgcacttctcgttctcaacttcgccgacgccgcacaaaca
ttttccgtcgtaggttccggcagctcgttcatgtacactctgcccgccggttcgctcgca
acctttacctggcagcccagcaccgccactccgaactaa

DBGET integrated database retrieval system