KEGG   Candidatus Koribacter versatilis: Acid345_4300Help
Entry
Acid345_4300      CDS       T00352                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Acid345_4300
Enzymes [BR:aba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Acid345_4300
Exosome [BR:aba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acid345_4300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5111600..5112631
Genome map
AA seq 343 aa AA seqDB search
MSFPISRPRRLRKNEAFRSLVRETRLSPAGFVYPLFVCPGEGVRKEVRSMPGVFNLSVDE
AVKEAQEVKSLGIPSVILFGLPESKDEQATGAWAEDGIVQQAARVIKREVPGLLLMGDVC
LCEYMSHGHCGIVQKTATNRSVGAASTAQMSGVDEYEILNDESLDILAKTAVSQARAGMD
IIAPSDMMDGRVAAIRDALDDEGFENIPILAYAAKFASGFYGPFREAADSAPAFGDRRSY
QMDGANLREAMIEIELDLEEGADMIMVKPAMPYLDVISEARRRYDVPLAAYQVSGEYAMI
KAAAQNNWIDHDRVMLESLQSIQRAGASIILTYFAKDVAKILG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagctttcccatcagccgtccccgtcgcctccgcaagaatgaagctttccgttcgctg
gttcgcgagacccgcctatcgccggccgggttcgtttacccgctattcgtgtgcccgggt
gagggcgtgcgcaaagaagtccgctccatgccgggagtcttcaatctgtcggtagacgag
gcagtgaaggaagcacaagaggtcaaatcgctcggcattccgtcggtcattttgttcgga
cttccggagagcaaggacgagcaggcaaccggcgcatgggctgaagatggcatcgtgcag
caggcggcgcgtgtaattaagcgcgaagtgccaggcttgctgctgatgggcgacgtttgt
ctctgcgaatacatgtcgcacgggcattgcggtattgtgcagaagaccgccaccaaccgc
tccgtcggcgcggcgtccactgcgcagatgagcggcgtggatgaatacgaaattcttaac
gacgaatcactcgatatcctggccaagaccgccgtctcgcaggctcgcgcgggcatggat
atcattgcccccagcgacatgatggacggccgggtcgccgccattcgcgacgctctcgac
gatgaaggcttcgagaacatcccgatcttggcctatgcggcgaagtttgcttccggcttc
tacgggccattccgagaagccgcggactcagcccctgccttcggcgatcgccgctcttac
caaatggatggcgctaacctccgcgaagccatgatcgaaatcgaactcgaccttgaagag
ggcgcagacatgattatggtgaagccggcgatgccctatcttgacgtcatctcggaagcg
cgccgacgttacgacgtgccgctcgccgcttaccaggtcagcggcgaatacgccatgatc
aaggccgccgcgcagaacaactggatcgatcacgatcgcgtaatgctggaatcgttgcaa
agcattcagcgcgccggggcgtcgatcatcttgacttactttgcgaaagatgtggcgaag
atcctcggttag

DBGET integrated database retrieval system