KEGG   Candidatus Koribacter versatilis: Acid345_4350Help
Entry
Acid345_4350      CDS       T00352                                 

Definition
2-oxoglutarate dehydrogenase E2
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acid345_4350
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acid345_4350
  Amino acid metabolism
   00310 Lysine degradation
    Acid345_4350
Enzymes [BR:aba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Acid345_4350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5159799..5161466
Genome map
AA seq 555 aa AA seqDB search
MPTDVIMPQMGESIFEGTITKWLKQPGDQVQRDEPLFEISTDKVDAEIPAPAAGILKEIK
AQAGQTVQVNTVVAIIDAAGSATTSAPKPAAAAPPKSAPQPDGVSSSAPSTSAPSVPAAG
PKTDVVMPQMGESIFEGTITKWLKNVGDTVQRDEPLFEISTDKVDAEIPAPVAGVLSEIK
VQAGATVQVNTVVATIGGAAGASARAPQAAAPAPSAPAPAAPAPQAPAAAEPEEEEISAS
GDRVRTSPLVRKMAKEANVDLGKVRGTGMGGRITKEDIQAFVEKQKTAPTPTPQPQAAQP
SAPAPAPSAPVAATPNKFAGTPGAIEPMSVMRKKIADHMVMSKRTSAHVHGVFEVDFTKI
VKLREKNKNSFQEKTGLKLTYTPFYARAVAHALRAWPIINASVEGENIHYKKDINLGIAV
ALDWGLIVPVVKQADGLSFVGLQRAITDLGERARAKKLKPEDVQGGTFTITNPGIFGAKF
GMPIISQPQLAILGIGAITKVPMVVTDKDGNDSIAIRSRCHISIGYDHRVIDGAVADQFM
VVVRDYLQNWNEPLI
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccgacgtcatcatgccccagatgggggaatcgatctttgaaggcaccatcacc
aaatggctcaaacaaccgggcgaccaggtccagcgcgacgagcccctcttcgaaatctcc
accgataaagtcgacgccgaaatccccgcccctgccgcgggcatcctgaaagaaatcaag
gcccaggccggccagaccgtacaggtcaacaccgtagtcgccatcatcgacgccgccggc
tccgcgaccacttccgctccgaaacccgccgccgctgcgccaccgaaatccgcgccgcaa
cccgatggcgtaagctcctctgccccgtcaacgagcgcgccgagcgtccccgccgctggt
cccaagaccgacgtcgtaatgccgcagatgggcgaatccatcttcgaaggcaccatcacc
aagtggctcaagaatgttggtgacaccgtccagcgcgacgagccgctcttcgaaatctcc
accgacaaagtggacgccgagatccccgccccagtagccggagtcctcagcgaaatcaaa
gttcaagccggcgccaccgtccaggtcaacaccgtcgtcgccaccatcggcggcgccgct
ggagccagcgcgcgcgcgccgcaagccgccgcacccgctccttccgcacctgctcccgca
gcccccgcgccacaagcgcccgctgcagccgagcccgaagaagaagaaatctccgctagt
ggcgatcgcgtccgcaccagtccgttagtccgcaaaatggcaaaagaagccaacgtagac
ctcggcaaagtccgcggcaccggcatgggtggacgcatcaccaaggaagacatccaggcc
ttcgtcgaaaaacaaaagaccgcgccgactccaacgccgcagccgcaagccgcgcaacct
tccgcgcccgcacctgctcccagcgcccccgtcgccgccacaccaaacaaattcgcgggc
actcccggtgccatcgagcccatgtcggtcatgcgcaagaaaatcgccgaccatatggtc
atgtcgaagcgcaccagcgctcacgtgcatggcgtcttcgaggtcgacttcaccaaaatc
gtgaagctccgcgagaaaaacaaaaacagcttccaggaaaagacaggcctcaagcttacc
tacacgccgttctacgcgcgtgcagtggcccacgcgttgcgcgcatggcccatcatcaac
gcctccgtcgaaggcgagaacattcactataaaaaggacatcaacctcggcatcgccgta
gctctcgactggggcctcatcgtcccggtggtcaagcaggccgacggcctaagcttcgtc
gggctccagcgcgccatcaccgacctcggcgaacgcgcccgcgccaaaaagctcaaaccc
gaagacgtccagggcggcaccttcaccatcaccaaccccggcatcttcggagcaaagttc
ggcatgccgatcatcagccagccccagctcgcgatcttaggcatcggcgcgatcacgaaa
gtccccatggtcgtcaccgacaaagacggcaacgacagcatcgccatccgctcgcgctgc
cacatctctatcggctacgaccaccgagtaatcgacggcgcagtcgccgaccagttcatg
gtcgtagtacgagactacctccagaactggaacgaaccgttaatctaa

DBGET integrated database retrieval system