KEGG   Candidatus Koribacter versatilis: Acid345_4350Help
Entry
Acid345_4350      CDS       T00352                                 

Definition
2-oxoglutarate dehydrogenase E2
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acid345_4350
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acid345_4350
  Amino acid metabolism
   00310 Lysine degradation
    Acid345_4350
Enzymes [BR:aba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Acid345_4350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5159799..5161466
Genome map
AA seq 555 aa AA seqDB search
MPTDVIMPQMGESIFEGTITKWLKQPGDQVQRDEPLFEISTDKVDAEIPAPAAGILKEIK
AQAGQTVQVNTVVAIIDAAGSATTSAPKPAAAAPPKSAPQPDGVSSSAPSTSAPSVPAAG
PKTDVVMPQMGESIFEGTITKWLKNVGDTVQRDEPLFEISTDKVDAEIPAPVAGVLSEIK
VQAGATVQVNTVVATIGGAAGASARAPQAAAPAPSAPAPAAPAPQAPAAAEPEEEEISAS
GDRVRTSPLVRKMAKEANVDLGKVRGTGMGGRITKEDIQAFVEKQKTAPTPTPQPQAAQP
SAPAPAPSAPVAATPNKFAGTPGAIEPMSVMRKKIADHMVMSKRTSAHVHGVFEVDFTKI
VKLREKNKNSFQEKTGLKLTYTPFYARAVAHALRAWPIINASVEGENIHYKKDINLGIAV
ALDWGLIVPVVKQADGLSFVGLQRAITDLGERARAKKLKPEDVQGGTFTITNPGIFGAKF
GMPIISQPQLAILGIGAITKVPMVVTDKDGNDSIAIRSRCHISIGYDHRVIDGAVADQFM
VVVRDYLQNWNEPLI
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccgacgtcatcatgccccagatgggggaatcgatctttgaaggcaccatcacc
aaatggctcaaacaaccgggcgaccaggtccagcgcgacgagcccctcttcgaaatctcc
accgataaagtcgacgccgaaatccccgcccctgccgcgggcatcctgaaagaaatcaag
gcccaggccggccagaccgtacaggtcaacaccgtagtcgccatcatcgacgccgccggc
tccgcgaccacttccgctccgaaacccgccgccgctgcgccaccgaaatccgcgccgcaa
cccgatggcgtaagctcctctgccccgtcaacgagcgcgccgagcgtccccgccgctggt
cccaagaccgacgtcgtaatgccgcagatgggcgaatccatcttcgaaggcaccatcacc
aagtggctcaagaatgttggtgacaccgtccagcgcgacgagccgctcttcgaaatctcc
accgacaaagtggacgccgagatccccgccccagtagccggagtcctcagcgaaatcaaa
gttcaagccggcgccaccgtccaggtcaacaccgtcgtcgccaccatcggcggcgccgct
ggagccagcgcgcgcgcgccgcaagccgccgcacccgctccttccgcacctgctcccgca
gcccccgcgccacaagcgcccgctgcagccgagcccgaagaagaagaaatctccgctagt
ggcgatcgcgtccgcaccagtccgttagtccgcaaaatggcaaaagaagccaacgtagac
ctcggcaaagtccgcggcaccggcatgggtggacgcatcaccaaggaagacatccaggcc
ttcgtcgaaaaacaaaagaccgcgccgactccaacgccgcagccgcaagccgcgcaacct
tccgcgcccgcacctgctcccagcgcccccgtcgccgccacaccaaacaaattcgcgggc
actcccggtgccatcgagcccatgtcggtcatgcgcaagaaaatcgccgaccatatggtc
atgtcgaagcgcaccagcgctcacgtgcatggcgtcttcgaggtcgacttcaccaaaatc
gtgaagctccgcgagaaaaacaaaaacagcttccaggaaaagacaggcctcaagcttacc
tacacgccgttctacgcgcgtgcagtggcccacgcgttgcgcgcatggcccatcatcaac
gcctccgtcgaaggcgagaacattcactataaaaaggacatcaacctcggcatcgccgta
gctctcgactggggcctcatcgtcccggtggtcaagcaggccgacggcctaagcttcgtc
gggctccagcgcgccatcaccgacctcggcgaacgcgcccgcgccaaaaagctcaaaccc
gaagacgtccagggcggcaccttcaccatcaccaaccccggcatcttcggagcaaagttc
ggcatgccgatcatcagccagccccagctcgcgatcttaggcatcggcgcgatcacgaaa
gtccccatggtcgtcaccgacaaagacggcaacgacagcatcgccatccgctcgcgctgc
cacatctctatcggctacgaccaccgagtaatcgacggcgcagtcgccgaccagttcatg
gtcgtagtacgagactacctccagaactggaacgaaccgttaatctaa

DBGET integrated database retrieval system