KEGG   Candidatus Koribacter versatilis: Acid345_4406Help
Entry
Acid345_4406      CDS       T00352                                 

Definition
peptidase M16-like protein
Orthology
K07263  
zinc protease [EC:3.4.24.-]
Organism
aba  Candidatus Koribacter versatilis
Brite
Enzymes [BR:aba01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     Acid345_4406
Peptidases [BR:aba01002]
 Metallo Peptidases
  Family M16: pitrilysin family
   Acid345_4406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5231450..5234281)
Genome map
AA seq 943 aa AA seqDB search
MTSFRRLFAILLLAAPLLAQSKLNVPTIAYEQYKLPNGLQVLMVEDHRLPLVGVDLWYHV
GPVKEKEGRTGFAHLFEHMMFEGSKHVGEKAHFKYLEAAGASDINGTTDFDRTNYFETLP
ANQLELALWLESDRMGFLLDTLDRTKLANQRDVVRNERRQSVEGQPYGIAEELMFHELYP
KGHPYYASVIGSHADVEAARLNDVREFFKQYYTPNNATLVITGDISKPAAKALVEKYFGP
IPQGPPVEAVNIKTPPITQEKRLNVTDQVQLPKVLLGWLAPAAFAPGDAEMILANQILGG
GKSSRLYRKLVYEQQIAQDATCFQESLALGSPMGCEITAKPNVTPEQIEKATNDVMADFL
ANGATQAELDRARTTIEARKIRNLERLGGFGGVADMLNYYNQYVGDPGYLPKDIARYDAV
TPESLLATAKSTLQQNQRVTMFCTPGKKVVDDVPRSPENTDADVKVEPEYTAEFDKAQAW
RATAPKAGPLPKLQLPVPAEFKLDNGLKVYLVPDHSLPLLAMRVMSLGGSDANTHEKSGV
AGFTAAMLTEGTANRTAPQIADETDKLGATLNTGATFDNAAVSMSVLSNNTDPAIDLLSD
VVLHPKFDAKETDRIRKERQTGLIQLRDDPFQLAIRVGNRAEFGTQSPYGEIELGTPESL
KSTTSDDLTNFWKSHYTPANSALIFSGDITEAKARELAKKYFGAWTAKGSATEPPKTVTA
QSRKIVLVDQPGAPQSVILAYGVGVPRSNPDYPAITVMNTMLGGLFSSRINMNLREKNGF
TYGAFSAFSWRRGAGPFFAGSQVRTDVTAPAARELFAELDGIRTRPLTADELKMSKDSVI
RSLPGDFETRAAVAAGVGNIWTYSLPLDYYRQIEGKIEAVTAEDTSRVAKQYVQPDKLLL
VTIGDKAKIESGLQELKLGPIELWTSDAEPMSAGSAAGGNKAQ
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctttccgtcgtttgtttgccattctcttgctcgcagcaccgctgctcgcgcaa
tccaagctcaacgttcccaccatcgcttacgagcagtacaagctacccaacggcctccag
gtgctgatggtcgaagaccatcgcctgccgctggttggcgtggatctctggtatcacgtc
ggcccggtgaaggagaaggaaggccgcaccggattcgcgcacctcttcgaacacatgatg
ttcgagggctccaagcacgtcggtgagaaggcgcacttcaagtacctcgaagctgccggc
gccagcgacatcaacggcactaccgatttcgaccgcaccaattacttcgagacgctgccc
gcgaaccagctagaacttgcgctctggctcgaaagtgaccgtatgggcttcctgctcgac
accctcgatcgcaccaagctcgccaaccagcgcgacgtggtccgcaacgaacggcgtcag
agcgtggaaggccagccttacggcattgccgaagagctgatgttccacgagctctatccc
aagggccatccctactacgcttccgtaattggctcgcatgccgatgtagaagccgcgcgc
ctcaacgacgtccgcgagttcttcaagcagtactacacgcccaacaacgccaccctggtc
atcaccggcgacatcagcaagcccgcggcgaaagcgctcgtcgaaaaatactttggcccc
atcccgcaaggcccgccggtagaagccgtcaacatcaagacgccgccgatcacgcaggaa
aagcgcctcaacgtaaccgaccaggtacagcttccaaaggttctgctcggatggctcgcg
cccgcagccttcgcgcccggcgacgcggaaatgattctcgccaaccagatccttggcggc
ggcaaatcgagccgcctctatcgcaagctcgtttacgaacagcaaatcgcgcaggacgcc
acttgcttccaggaatcgctcgccctcggttcgccgatgggctgcgaaatcaccgccaag
cccaatgtcacgcctgagcagatcgagaaagccacgaacgacgtgatggctgacttcctc
gccaatggcgcaacgcaagccgaacttgatcgcgctcgcaccacgatcgaagcccgcaag
atccgcaacctcgagcgtcttggcggcttcggcggcgtcgctgacatgctgaactactac
aaccagtacgtcggcgatcccggctacctgcccaaagacatcgcgcgttatgacgccgtg
actcccgagtcgctgctcgcgaccgcgaagtccaccctgcagcaaaaccagcgggtcacg
atgttctgcacgccgggcaaaaaagttgtggacgacgttccccgcagccccgagaacact
gacgccgatgtgaaggtcgagcccgagtacaccgcggagttcgacaaggcgcaggcgtgg
cgcgccaccgcgcccaaggccgggccactgcccaagctgcaactgccagtgcctgccgag
ttcaagctcgacaacggcctgaaggtttacctcgtgcccgaccactcgctgccgctgcta
gctatgcgcgtgatgtcgcttggcggctccgacgcgaatacccatgagaagtccggtgtc
gcaggcttcaccgccgccatgctcaccgaaggcaccgccaatcgcacggcgccgcagatc
gccgatgagaccgataagctcggcgccacgctcaacaccggcgcaacattcgataacgct
gccgtctccatgagtgtgctcagcaacaacaccgaccccgcgattgaccttctctctgac
gtcgtgctgcatcccaagttcgacgctaaggaaaccgatcgcattcgcaaggagcgccag
accgggctcatccaactccgcgacgatcccttccaactcgcaattcgcgttggcaatcgc
gccgagttcggtacccagagtccgtacggcgaaatcgaactcggcactcccgagtcgttg
aagtccaccaccagcgacgacctaacgaacttctggaagtcgcactacacccccgcgaac
tcggcgctcatcttctccggcgacattaccgaagcgaaagcgcgcgagctcgcgaagaaa
tacttcggcgcatggacggcgaagggaagcgcaaccgagcccccaaagacggtcaccgcg
caatcgcgcaagatcgtcctcgtcgatcagcccggcgcgccgcagtcggtcatcctcgcc
tacggcgttggtgttccgcgcagcaatcccgactatcccgcaattaccgtgatgaacacc
atgcttggcggcctgttctcgtcgcgcatcaacatgaacctgcgcgaaaagaacggcttc
acctacggtgccttctcggcgttctcgtggcgtcgcggcgctggcccgttcttcgccggc
tcccaggtccgtactgatgtcaccgcccccgccgcgcgtgaactcttcgccgaactcgac
ggcatccgcactcgtccgctcacggccgatgagttgaagatgtcgaaggacagcgtcatc
cgttcgctgcccggcgacttcgaaacccgtgccgcggtggctgccggtgtcggcaacatc
tggacctacagcctcccgctggactactaccgccagatcgaaggcaagatcgaagccgtc
actgcggaagatacgtcgcgtgtcgcgaagcaatacgtccagcccgataagctccttctc
gtcaccatcggcgacaaagcaaagatcgaatccggtctgcaagagttgaagttaggcccc
atcgagctctggaccagcgacgccgaacccatgtcagcaggctccgccgccggaggcaat
aaagcgcagtaa

DBGET integrated database retrieval system