KEGG   Candidatus Koribacter versatilis: Acid345_4482Help
Entry
Acid345_4482      CDS       T00352                                 

Definition
class II aldolase/adducin-like protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Acid345_4482
Enzymes [BR:aba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Acid345_4482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5320515..5321177
Genome map
AA seq 220 aa AA seqDB search
MKSLETQKLEIVKIGQWLHTKGFVAAMDGNVSVRLSGDTVLCTPTCISKGMMEPDDLVLV
DMQGKRIEGHREVSSEIQMHLLIYRMRPDVRGVVHAHPPTATGFASAGMTLDSALASEIV
VALGAVPLANYGTPGTPELLEALEPFVPDHQAILMANHGAVTYAEDVLHAYMHMETVEHF
AKISLVTHLLGRQELLSNENMDKLRVVRQKYLAMQAVANE
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcctcgaaacgcagaagctcgaaatcgtgaagattgggcagtggctacacacg
aaggggttcgtggcagccatggatggcaacgtctccgttcgcctgagtggagacacggtc
ctgtgcactcccacgtgtatcagtaaaggcatgatggagccggacgacctcgtgctggtt
gatatgcagggaaagcgcatagagggccatcgcgaagtctcgagcgagatccagatgcac
ctcctgatctaccgcatgcgtcccgatgttcgcggagtggtacatgcacatccgccaacg
gcgacgggcttcgcatccgccggcatgacactagattcagcgctggcttcggagatcgtc
gtcgcactcggcgcggtcccgctagcaaactatggcacgcccggaacaccggaactcctt
gaggcactggagcccttcgtccctgatcaccaagcgatcctgatggccaaccacggcgcc
gtgacttacgcggaagacgtgctgcacgcctacatgcacatggaaaccgtggagcacttc
gcgaagatttcgctcgtcacgcacttgctcggacgccaagagctgctcagcaacgaaaat
atggacaagctgcgcgtcgtgcgtcagaagtatttggcaatgcaggcagtggcgaacgaa
taa

DBGET integrated database retrieval system