KEGG   Candidatus Koribacter versatilis: Acid345_4484Help
Entry
Acid345_4484      CDS       T00352                                 

Definition
glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Acid345_4484
  Lipid metabolism
   00600 Sphingolipid metabolism
    Acid345_4484
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Acid345_4484
Enzymes [BR:aba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Acid345_4484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5323842..5326991
Genome map
AA seq 1049 aa AA seqDB search
MRRLAAFFFLFALLGVLGFAQTPDWENPRVFGINREAPRATFTPFPDEASALKRREQPSV
FMQSLNGMWKFHWVKSPEERPQDFYQPNYDVSAWKEIRVPANWEMEGYGTPIYTNIIYPF
ERDAPRVTTAPADHSWTAYLQRDPVGSYRRDFTLPDSWNGRETFLVFDGVNSAYYLWING
QKVGYSQDTRMMAEFNITKYLKPGTNTIAVEVYRWCDGSYIEDQDFWRMSGIYRNVTLVS
RAPLHIRDFQVQTPFDAQYRDAILKVRVDVRNLGASNSAATLEAQLLDDNSKPVFAILAK
RVQLEQNKETSITLEQLVKAPKQWSAEIPNLYQLLLTLKDADGKTLEVIPWKIGFRQSEI
KGDQILFNGKKLMIKGVNRHEFDPDLGQVVTRERMIQDIRIMKQNNINAVRTSHYPNVPE
WYELADEYGLYILDEANVESHGYDSEAQQRISTGEDYTDAIVDRIHRTIERDKNHPSIIG
FSLGNEAGWGRNMAAERDWAKAHHPEFFIIYQPHDSVHGDALSPMYVKPQEIVGYYKEHG
QGRPFFEIEYAHAMGNGTGNFQQYWDVFDSERWAHGGFIWDWVDQGIRRKNAQGREIWAY
GGDFGDKPNDDNFVTNGLVLPDRTPHPGLTEVKHSYANIKVEAVDLAAGEFRIRNKYNFR
DLSFVRGTWVLEENGNAIKAGEIPASSVAPLATQEVTIDLSRPAIRPTADYLVTIRYELR
ESTPWAPKGHVIAWDQFALESGRELSSAVRRERAPTLKIEDMEHQFAVYNDRFSITIGKE
SGSIESFTLDGKNLITAPLSPNFWRAPTDNDRGNGMPQRQAIWRLAGQNREVQSVKAEQP
QPNLVRIATEMKLPAGNSTQKYTYTIHGDGTVEIASTLHADPSLPDLPRVGMQMRVLGSL
RNVEWFGRGPDENYWDRNLASNVGLYKNTMDKMWFPYIEPQETGNRTDVRWVTFTDDQGF
GFKATGEPLLNFSAWPFRMSEIEHEKSPVNIGRKHAGDIEMSDDITVNLDYKQMGVAGDD
SWGAPVHKEFTLPASDYTYRFRLEPVGVK
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atgagacgactcgctgccttcttcttccttttcgcgcttttgggtgtgctcggtttcgcg
caaacccccgactgggagaaccctcgcgttttcggcatcaatagagaagcgccgcgcgcg
accttcaccccatttccagacgaggcctcggcgcttaagcgtcgcgagcaaccgtctgtc
ttcatgcaatcgctgaacgggatgtggaagttccactgggtaaaaagccctgaagagcgg
cctcaggatttctatcagccgaactacgacgtgagtgcatggaaagagattcgcgtgccc
gcgaactgggagatggaaggctacggcactccgatctataccaacatcatttatcccttt
gagcgcgatgccccgcgtgtgacgaccgcgcccgccgatcactcctggaccgcatacctg
caacgcgatcccgtcggatcgtaccgccgcgacttcacgcttccggattcatggaatggc
cgcgaaacgtttctcgtcttcgacggcgtcaactccgcctactacctgtggatcaacggc
cagaaggtcggctacagccaggacacccggatgatggcggaattcaatatcaccaagtac
ctgaagccgggcaccaacaccatcgccgtcgaagtctatcgctggtgcgacggcagctac
atcgaggaccaggacttctggcggatgagcggcatctaccgcaacgtgacgctggtctcg
cgcgcgccgctgcacatccgcgacttccaggtgcaaacgccattcgacgcgcagtatcgc
gacgcgatcttgaaggtcagagtcgatgttcgcaatcttggcgcaagcaactcggctgca
acgcttgaagcgcaattactcgacgacaatagtaagccggtctttgcaatccttgcgaag
cgcgtgcagctggagcagaacaaagaaacttccatcacgctcgagcagctcgtgaaggca
ccgaagcaatggtccgccgaaattccaaacctttaccagcttctgctcacgctcaaagac
gcagatggcaagacactcgaagtgatcccgtggaagatcggtttccgccagtccgaaatc
aaaggcgaccagattctcttcaacggcaagaagctgatgatcaaaggcgtgaaccgccac
gagttcgatcccgacctcggacaggtggtcacccgcgagcgcatgatccaggacatccgg
attatgaagcagaacaacatcaacgctgtccgcacctcgcattaccccaacgttccagag
tggtacgagctcgccgacgaatatggcctctatatcctcgatgaagccaacgtcgaatcg
cacggctacgacagcgaagcccagcagcgtatctccacgggcgaagactacaccgacgcc
attgtcgaccgcatccatcgcactattgagcgcgacaagaaccatccctcaatcatcggc
ttctcactcggtaacgaagccggttggggccgcaatatggccgccgagcgcgattgggcg
aaagcgcaccaccccgagttcttcatcatctaccagccgcacgacagcgttcacggcgac
gccctctcgccgatgtacgtgaagccccaggaaattgtgggctactacaaagagcacggc
caaggtcgcccattcttcgagattgagtacgcgcacgccatgggcaacggcaccggaaac
ttccagcagtattgggacgtcttcgattccgaacgctgggcccacggcggcttcatctgg
gattgggtcgaccagggcatccgccgcaagaacgcgcaaggccgcgaaatctgggcgtac
ggtggcgacttcggcgacaagcccaacgacgacaacttcgtcaccaacggcctcgtgctc
cctgatcgaactccgcacccaggtctcaccgaagtaaagcactcgtacgccaacatcaag
gtcgaggcagttgatctcgccgccggcgagttccgcattcgcaacaaatacaactttcgc
gatttgagttttgtccgcggaacctgggtactggaagagaacgggaacgcgatcaaggct
ggcgagatacccgcaagcagtgttgctccgctcgctactcaggaggtcacaatcgatctc
agccgcccagcgattcgccccaccgctgactatctcgtgacgattcgatatgaattgaga
gaatctacaccatgggcgccgaagggacatgtgatcgcgtgggatcagtttgcgcttgag
agtggaagagaactctcatccgcggtgcgccgggagcgcgcgccgacgctcaagatcgaa
gacatggagcaccagttcgccgtctacaatgatcgcttctcgatcaccatcggcaaagag
agcgggtccatcgagtccttcacgctcgacggcaagaacttgatcaccgcgcctctctcg
ccgaacttctggcgcgcgcccactgacaacgaccgcggcaacgggatgccgcagaggcag
gcgatctggcggcttgccggccagaaccgtgaagtgcagagcgtgaaggcggaacagccg
cagccgaatctcgtaagaatcgcaaccgagatgaagctacccgccggaaactccacacag
aaatacacgtacaccatccacggcgatggcaccgtggaaatagccagcaccctccacgcc
gatccctcgctccccgaccttccccgcgtcggcatgcaaatgcgcgtcctaggctctctg
cgcaacgtcgagtggttcggccgcggacccgacgaaaactactgggaccgcaacctagcc
tccaacgtcggcctctacaagaacaccatggacaaaatgtggttcccctacatcgagccg
caggaaaccggcaaccgcaccgacgttcgctgggtgaccttcaccgatgaccaaggcttc
ggtttcaaagccactggcgagccactcctcaacttcagcgcctggcctttccgcatgtcg
gagatcgagcacgaaaagtctccggtcaacatcggacgcaagcacgccggcgacatcgaa
atgtccgacgacatcaccgtcaacctcgactacaaacaaatgggcgtagccggcgacgac
agttggggtgcaccagtccacaaagaattcacgctgcctgcgagcgactacacgtatcgc
ttccgattggagccggtcggagtcaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system