KEGG   Candidatus Koribacter versatilis: Acid345_4496Help
Entry
Acid345_4496      CDS       T00352                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Acid345_4496
Enzymes [BR:aba01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Acid345_4496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5336624..5337532
Genome map
AA seq 302 aa AA seqDB search
MYQWNVGSRIVELGKRTLVMAVLNVTPDSFSDGGQFPSAEAAVEAGLQMIADGADILDIG
GESTRPGVKVGSDAVVSAEEELRRVLPVVEGLKKARPEILISADTYKAEVARRTVTAGAE
IVNDVSGMSWDPQMIGTVAELACGVVVMHSRGTPEDWRDLPAEPRIVQVVQQGLHEATQK
AIAAGVHHERIIVDPGFGFGKRLENNYPLLAKLEDLHSIGFPLMVGVSRKSFLAKTAGAK
LASELKPLERLHPSIAAAVIAAMKGAHIVRVHDVRPTVEAMAIVDAVMLSSEDMNPWFEA
YS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtatcagtggaatgtcggcagccgcattgtcgagttgggtaaacgcacgctcgttatg
gccgtgctcaacgtgacgcccgattcgttcagcgatggcgggcagttcccgtcggcggaa
gcggcggtcgaggccgggctgcagatgatcgcggacggcgcggacattctggacattggt
ggagagtcgacgcggccgggagtgaaggtgggatcggacgccgtggtctcagccgaggag
gaactacgtcgagtgcttccggtggttgagggtctgaagaaagcgcgaccggagatattg
atcagcgccgatacgtataaagccgaggtggcacggcgcacggtgaccgctggggcggag
atcgtcaacgacgtgagcgggatgagttgggatccgcagatgataggaaccgttgcggaa
ttggcttgcggcgtggtggtgatgcattcacgaggtacgccagaggactggcgagatttg
ccggcggagccgcggatcgtgcaggtcgtgcagcagggcttacatgaagcgacacagaag
gccattgcagccggagtgcaccacgaaaggattatcgtggatccgggcttcggatttggg
aagcggctggagaacaactatccgctgctggcgaagttggaggacctccacagcattggg
ttcccgctgatggtgggagtctctcgcaagagtttcctggcgaagacggcgggggcgaag
ctcgccagcgagttgaagccgctggagagattgcatccgtcgattgcggcggcggtgatt
gccgcgatgaagggcgcgcatatcgtgcgggtgcatgatgtgcgaccgacggttgaggcg
atggcgatcgtggatgcggtgatgctgagcagcgaggacatgaatccgtggtttgaagcc
tattcgtag

DBGET integrated database retrieval system