KEGG   Candidatus Koribacter versatilis: Acid345_4550Help
Entry
Acid345_4550      CDS       T00352                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Acid345_4550
   00052 Galactose metabolism
    Acid345_4550
   00500 Starch and sucrose metabolism
    Acid345_4550
   00520 Amino sugar and nucleotide sugar metabolism
    Acid345_4550
Enzymes [BR:aba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Acid345_4550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5396394..5397293
Genome map
AA seq 299 aa AA seqDB search
MKTIRKAVFPAAGLGTRFLPATKAQPKEMLPIVDKPIIQYGVEEALDAGCDQIIIVTGRG
KSSIEDHFDVSYELEKMLEERGKTELLSIVRKISDMIHVAYVRQKEALGLGHAVLMSKEL
VGDEPFAVLLADDVIDAEPSCLKQMVEVFNATQCSVIATQVVEGKAISSYGVLDAKPVTS
GPFAGRLFEISDLVEKPKPEEAPSNQAIIGRYLLTPTVFDCLQNIPTGAGGEIQLTDGLR
ALLKREKIYGFQFEGKRHDAGDKLGFLKATVEFALKNPELGPGFAKYLRELNVEEFAMK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccatccgcaaagccgtcttccccgccgctggcttgggcacacgcttccttccc
gccaccaaagcgcaacccaaggaaatgctcccgatcgtcgacaagccgatcatccagtac
ggtgtggaagaagcgctcgacgcaggttgcgaccagatcattatcgtcactggacgcggc
aaaagttccatcgaagaccacttcgacgtcagctacgaactcgagaagatgctcgaagag
cgcggcaagaccgaactcctctccatcgtccgcaaaatttccgacatgatccacgtcgcc
tatgtgcgccagaaagaagcgctcggcctcggccacgccgtgctgatgtcgaaggagctt
gtcggcgacgaacccttcgccgtcctcctcgctgacgatgtcatcgatgccgagccgtct
tgcctcaagcagatggtcgaggtcttcaacgcgacgcaatgctccgtcatcgccacccag
gttgtcgaaggcaaagcgatctcgtcgtatggtgtgcttgacgctaagcccgtcacatcc
ggcccattcgccggaaggctcttcgagatcagcgatctcgtcgagaaaccgaaacccgaa
gaagctccttcgaaccaggccatcatcggccgctatctcctcacgccgacggtcttcgat
tgtctccagaacatccccaccggcgcagggggcgagatccagctcaccgatggccttcgc
gccctgctcaagcgcgaaaaaatctacggtttccaatttgaaggcaagcgccatgacgcc
ggcgacaaactcggcttcctcaaagcgactgtcgaattcgcattgaaaaacccggaactc
ggtccgggttttgcgaagtaccttcgcgaattgaatgtagaagagttcgctatgaagtaa

DBGET integrated database retrieval system