KEGG   Candidatus Koribacter versatilis: Acid345_4550Help
Entry
Acid345_4550      CDS       T00352                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00040  Pentose and glucuronate interconversions
aba00052  Galactose metabolism
aba00500  Starch and sucrose metabolism
aba00520  Amino sugar and nucleotide sugar metabolism
aba01100  Metabolic pathways
aba01130  Biosynthesis of antibiotics
Module
aba_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Acid345_4550
   00052 Galactose metabolism
    Acid345_4550
   00500 Starch and sucrose metabolism
    Acid345_4550
   00520 Amino sugar and nucleotide sugar metabolism
    Acid345_4550
Enzymes [BR:aba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Acid345_4550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABF43550
JGI: Acid3454550
UniProt: Q1IHV0
Position
5396394..5397293
Genome map
AA seq 299 aa AA seqDB search
MKTIRKAVFPAAGLGTRFLPATKAQPKEMLPIVDKPIIQYGVEEALDAGCDQIIIVTGRG
KSSIEDHFDVSYELEKMLEERGKTELLSIVRKISDMIHVAYVRQKEALGLGHAVLMSKEL
VGDEPFAVLLADDVIDAEPSCLKQMVEVFNATQCSVIATQVVEGKAISSYGVLDAKPVTS
GPFAGRLFEISDLVEKPKPEEAPSNQAIIGRYLLTPTVFDCLQNIPTGAGGEIQLTDGLR
ALLKREKIYGFQFEGKRHDAGDKLGFLKATVEFALKNPELGPGFAKYLRELNVEEFAMK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccatccgcaaagccgtcttccccgccgctggcttgggcacacgcttccttccc
gccaccaaagcgcaacccaaggaaatgctcccgatcgtcgacaagccgatcatccagtac
ggtgtggaagaagcgctcgacgcaggttgcgaccagatcattatcgtcactggacgcggc
aaaagttccatcgaagaccacttcgacgtcagctacgaactcgagaagatgctcgaagag
cgcggcaagaccgaactcctctccatcgtccgcaaaatttccgacatgatccacgtcgcc
tatgtgcgccagaaagaagcgctcggcctcggccacgccgtgctgatgtcgaaggagctt
gtcggcgacgaacccttcgccgtcctcctcgctgacgatgtcatcgatgccgagccgtct
tgcctcaagcagatggtcgaggtcttcaacgcgacgcaatgctccgtcatcgccacccag
gttgtcgaaggcaaagcgatctcgtcgtatggtgtgcttgacgctaagcccgtcacatcc
ggcccattcgccggaaggctcttcgagatcagcgatctcgtcgagaaaccgaaacccgaa
gaagctccttcgaaccaggccatcatcggccgctatctcctcacgccgacggtcttcgat
tgtctccagaacatccccaccggcgcagggggcgagatccagctcaccgatggccttcgc
gccctgctcaagcgcgaaaaaatctacggtttccaatttgaaggcaagcgccatgacgcc
ggcgacaaactcggcttcctcaaagcgactgtcgaattcgcattgaaaaacccggaactc
ggtccgggttttgcgaagtaccttcgcgaattgaatgtagaagagttcgctatgaagtaa

DBGET integrated database retrieval system