KEGG   Candidatus Koribacter versatilis: Acid345_4564Help
Entry
Acid345_4564      CDS       T00352                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
aba  Candidatus Koribacter versatilis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aba00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:aba00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5410711..5412585
Genome map
AA seq 624 aa AA seqDB search
MIRRILALLLTLTTLFPSAFAKDRFQQPGPVHLDKDGEKWADKTLKSMSLEEKVGQMFMI
WSKAQFVNVQSPDFLKLRDTMARYHLGGFGVTVNFEDGFLFKTEPYEAAMMINELQQGSE
IPLIIAADFERGLSMRLKEATDFPHAMAFGATNNPAYAKEFGRITALESRAIGVEWNWFP
DADVNSNPANPIINTRSFGEDPQAVASMVKAYIEGAHAEGLLTTVKHFPGHGDTDTDTHL
ATARINQPLEHIQNVELVPFKAAIDAGVDSVMIGHLVVPALDPDTNRVATISPKIVNGTL
KKDLGFQGLVVTDAMEMNGLAKLFGFGPEGSARAAVAAVKAGDDMLLLPSDLDGAYEGLI
KAVKRGEIPESRIDESVRKILRMKASVGLNKAKLVDVEQMKNLIARPDSLSVAQEIADSA
VTLVRSNDKTLPLRAKTVGTSGPHATYEKPEGVRGRQLAVIITDDSRSESGRIFDQQIRR
RSPEMRTIWVDDRNAVGMSDTVLQAVREAEKVVVAIYAIPSAGRVKVENGQFKASSDMSD
APAALVKNILRVAGSRTVVVAMGNPYLAQDFPEVQNYMCTYSNAQVSDVAAVKALFGDIA
IRGHLPVTIPQFAERGAGIQLPAK
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcagaatcctggccctcttactcacgctcactaccctctttccatcggcgttt
gccaaagacagatttcagcagccggggcccgtgcatctggacaaggacggcgagaagtgg
gccgataagaccttgaagagcatgtcgctcgaagagaaggttgggcagatgttcatgatc
tggtcgaaggcccagtttgtgaacgtgcagagcccggattttctcaagctgcgcgacacc
atggcgcggtatcacctgggcgggttcggcgtgaccgtgaatttcgaagatgggttcctg
ttcaagaccgagccgtacgaggccgcgatgatgatcaacgagttgcagcagggctcggag
ataccgctgatcattgccgccgatttcgagcgcgggctctcgatgcgtctgaaggaagcc
actgatttcccgcacgcgatggcgtttggggcgactaacaatccggcgtatgcgaaggag
tttgggcggatcacggcgctggagtcgcgcgccattggcgtggagtggaactggtttcct
gatgccgacgtgaattcgaacccggcaaacccgatcatcaatacgcgctcgtttggcgag
gacccgcaggcggtggcgtcgatggtgaaggcctacatcgagggcgctcatgcggaaggc
ctgctcacgacggtgaagcacttccccggtcacggcgacaccgataccgacacacacctg
gctacagcgcgaatcaatcagccgctggagcatatccagaacgttgagttggtgccgttc
aaggccgcgattgatgcgggcgtggactcggtgatgatcggacatctcgtggtgccggca
ctcgatcccgataccaatcgggttgcgactatctcgccgaagatcgtgaacggcactctc
aagaaagacctcgggttccaggggctcgtcgtcaccgatgcaatggagatgaacgggctg
gcgaagctgttcggcttcgggccggaaggctcggcgcgagcggccgtagcggcagtgaag
gccggtgatgacatgcttctgctgccgtcggacctcgacggcgcgtacgaagggctgatc
aaagcggtgaaacgcggcgagattccggagtcgcggattgacgagtcggtgcggaagatc
ctgcggatgaaggcttcggtggggctgaacaaggccaagctggtagacgtggagcagatg
aagaacctcatcgcgcgtccggatagcctgtcagtggcgcaggaaatcgcggattccgcg
gtgacactggtgcgcagcaacgacaaaaccctgcccctgcgggcgaaaacagtgggaacc
agcgggcctcatgcaacgtatgagaaaccagagggagtccggggaaggcagcttgcggtc
atcataacggatgattcgcggagcgagtcgggccggatcttcgatcagcagattcggcgg
cgatcgccggagatgcggaccatctgggtggatgatcgcaacgccgtgggcatgagcgac
accgtattgcaggcggtacgcgaggcggagaaagttgtggtcgcgatttacgcgattccc
agcgccggacgcgtgaaggtggagaacggccagttcaaggcctcgagcgacatgagcgat
gcgccggcggcgctggtgaagaacattttgcgcgtagctgggagccgcacggtggtggtc
gcaatggggaatccgtatctggcgcaggatttcccggaagtgcagaactatatgtgcacg
tattccaatgcgcaggtttcagacgtagcggcggtgaaagcgctgttcggcgacatcgct
attcgtggtcacctgccggtgacgattccgcagttcgccgagcgcggcgcggggatccag
ctaccggcaaagtag

DBGET integrated database retrieval system