KEGG   Candidatus Koribacter versatilis: Acid345_4569Help
Entry
Acid345_4569      CDS       T00352                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00240  Pyrimidine metabolism
aba00250  Alanine, aspartate and glutamate metabolism
aba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Acid345_4569
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acid345_4569
Enzymes [BR:aba01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Acid345_4569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABF43569
JGI: Acid3454569
UniProt: Q1IHT1
Position
5416250..5417161
Genome map
AA seq 303 aa AA seqDB search
MKSKKPRSLLGIEGMESKEINALLKLAARMEPTRRRNTLRGKTVVLLFYENSTRTRSSFE
LAAKVLGATTILITATASSIEKGESLIDTGYTVRALGADAIVMRHPSSGAHWLLAEHLDI
PIINAGDGMHEHPSQGLLDALTILQAKKKFKGLKIAIVGDIYHSRVARSNVHLLPKLGAK
VVLCGPPDLCPDEMAKIASGIEVSHNLDHALSGADVVMSLRVQKERLVGRQIGVEDYIAN
YQITPEKLALAKKDAVLMHPGPIIRGMELTSEVADGHASKILAQVHNGVKVRMAILQTLL
AKN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgaaaaagccccgctccctgcttggcatcgaaggcatggagtccaaagagatc
aacgccctcctgaaactcgccgcccgtatggagccgacgagacgccgcaacacccttcgt
ggcaaaaccgttgtccttctcttttacgaaaattcgacacgtacgcggtcttcgttcgaa
ctagccgcgaaggtgctaggagcaacaacgatcctcatcacagcgacggcgtcttcgatt
gagaagggcgagtcgctgattgataccggctacaccgtgcgggcgctcggcgcagatgca
atcgtgatgcgacatccctcctctggggcacactggctgctggcggagcacctcgatatc
ccgatcattaacgctggggacggtatgcacgaacatccgtcgcagggattgctcgatgcg
ctgacgatcttgcaggcgaagaagaagttcaaagggctcaagatcgcgattgtcggagat
atctatcattcgcgtgtggcgcgttcgaatgtgcacctgctgccgaagctgggagcgaag
gtggtgctgtgcgggccgccggatttgtgtccggatgagatggcgaagatcgcgtcggga
attgaggtatcgcacaacctcgatcacgcgctcagtggggccgatgtggtgatgtcgctg
cgggtgcagaaagaacggctcgtgggacggcagatcggcgtggaagattacattgccaac
taccagatcacgccggaaaagcttgcgctggcgaaaaaggatgcagtgttgatgcatccg
gggccgatcattcgcgggatggagttgaccagcgaagtcgcggacgggcatgcgtcgaag
atcctcgcgcaggttcacaacggcgtgaaggtgcggatggcgatactgcagacgctgctg
gctaaaaactaa

DBGET integrated database retrieval system