KEGG   Candidatus Koribacter versatilis: Acid345_4584Help
Entry
Acid345_4584      CDS       T00352                                 

Definition
zinc-binding alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Acid345_4584
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acid345_4584
  Lipid metabolism
   00071 Fatty acid degradation
    Acid345_4584
  Amino acid metabolism
   00350 Tyrosine metabolism
    Acid345_4584
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Acid345_4584
   00626 Naphthalene degradation
    Acid345_4584
Enzymes [BR:aba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Acid345_4584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5431790..5432791
Genome map
AA seq 333 aa AA seqDB search
MKAFVVDRYGKKESGRIGEMPNPKLQDDDVLVQVHAAGVNLLDSKIKNGEFKLVLPYRLP
LILGHDVAGVVVEVGPRVQRFKPRDEVYSRPDDLRIGAFAELIAIKEDSLAIKPKALTME
EAASIPLVGLTAWQALVDKANLTKGQKVFIQAGSGGVGTFAIQLAKHLGATVATTTSAAN
FDLVKQLGADIAIDYRKDDFEKILRDYDVVLNSQDKPTLEKSLRVLRPGGKLISISGPPD
PEFAKESGSNWIVRSVMRVLSYGIRKQAKRQRVSYSFLFMRANGDQLREISALVDSGIIR
PVVDRVFPFESTGEALAYVEKGRVKGKVVVSLR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcattcgtcgtcgaccgttacggaaaaaaggagagcggacgaattggcgaaatg
ccgaatccgaagctgcaggacgatgacgtattggtccaggtgcatgccgctggcgtaaac
ctgctggattcgaaaatcaaaaatggcgagttcaagctggttttgccctatcgcttaccg
ctgattcttggccatgacgtggctggcgtggtggttgaagtcggcccgcgagtacaacgt
ttcaagcctcgagatgaggtctattcgcggccagatgacttgcgtatcggtgcattcgcg
gaattgattgcgatcaaggaagattcgctggcaatcaaacctaaagcactgaccatggaa
gaagctgcttccatcccgctggtcgggttaaccgcatggcaagcgctggtcgacaaagcg
aatctgacgaagggacaaaaggtcttcatccaggcgggctccgggggcgtgggaacattt
gccattcagttggcgaaacatttgggcgccacggtggcgacaaccacgagcgccgccaat
tttgatttggtgaaacaactcggcgcagatattgcgatcgattacaggaaagatgatttc
gaaaagatattgcgtgactatgacgtggtgttgaacagccaggacaagccgacgctggaa
aaatctctacgagtgctcagacccggtggaaagctgatctcgatctcaggtccccccgat
cccgagtttgcgaaagaaagtggatcgaattggatcgtgagatcggtgatgcgcgttttg
agctatggaatcaggaagcaggcaaagcgccagcgggtcagctattcatttcttttcatg
agagcaaacggggaccagttgcgcgagatttccgccctcgtggattccgggatcatacgc
ccggttgtggaccgcgtctttccatttgaatcgactggggaggctttggcttacgtcgaa
aaaggacgcgtaaaaggcaaagtcgtcgtttcgttgaggtga

DBGET integrated database retrieval system