KEGG   Candidatus Koribacter versatilis: Acid345_4706Help
Entry
Acid345_4706      CDS       T00352                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acid345_4706
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Acid345_4706
Enzymes [BR:aba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Acid345_4706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5565131..5566447)
Genome map
AA seq 438 aa AA seqDB search
MATENPTAQLRLDWETNPRWKGITRPYTAEDVARLRGTIRIDHTLARLGAERLWKLLQED
KYTQALGALTGNQAVQMVKAGLKAIYVSGWQVAGDANDAGQMYPDQSLYPADSVPNLVRR
LNNALLRADQIHHSEGKNGMYFLAPMIADAEAGFGGNLNAFELMKAMIESGAACVHFEDQ
LSSAKKCGHLGGKVLVPTGEAIQKLVAARLAADICGVPTLILARTDANSAHLLTSDIDPY
DREFCTGERTSEGFFCIRGGLDSAIARGLAYAPYADLIWCETSEPNIGEAQRFAEAIHAK
FPGKMLAYNCSPSFNWKKKLSEEDIARFQPALAEMGYKFQFITLAGFHALNLSMYELATG
YRQSGMTAYSALQQREFQLEPEGYEAAKHQRFVGTGYFDQVQNVVTSGKASTRALEHSTE
AEQFHASETPEKSGVAAD
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggagaacccgactgcccagcttcgccttgactgggagaccaacccacgctgg
aagggcatcacccggccttacaccgcagaagacgttgcgcgattgcgcggcaccattcgc
attgaccacacgctggcgcgcctcggcgcagagcggctgtggaagctgcttcaagaagac
aaatacacccaggcgctcggtgcattgaccggcaaccaggcggtgcagatggtcaaagcc
ggattgaaagcgatctacgtctcgggctggcaagtggcgggcgacgccaatgacgcgggc
caaatgtatcccgaccaaagcttgtatccggcagatagcgttccgaaccttgtgcgccga
ttgaacaacgcactgttgcgcgccgatcagatccatcactccgaggggaagaatggaatg
tatttcctcgcgccgatgatcgccgatgccgaagccggcttcggcggcaacctcaacgcc
ttcgagttgatgaaagcgatgatcgagtcgggagcagcctgcgttcacttcgaggaccaa
ctgtcttcggcgaagaagtgcgggcacctcggcggcaaagttctggtaccgaccggcgaa
gcgatccagaagctggtcgcagctcgcttggcagccgacatctgcggcgtgccgacgctg
atcctggcgcgtaccgatgcgaacagcgcccatctgctcaccagcgacatcgatccctac
gatcgcgagttctgcaccggcgagcgcaccagcgaaggcttcttctgcattcgcggcggg
ttggattccgccatcgcgcgcggcttggcctacgcaccgtatgcggacctgatctggtgc
gaaacttcggaacccaacatcggcgaggcgcagcgcttcgcggaggcgatccatgcgaag
tttccgggaaagatgcttgcttacaactgctctccgtcgttcaactggaagaagaaattg
tcggaggaagacatcgcgcgcttccagccggcgctcgcggaaatgggttacaagttccag
ttcattaccctggcggggttccatgcgctgaacctcagcatgtacgagttggccacgggt
tatcgtcagagcggcatgacggcctattccgccctgcagcagcgggaattccaactggag
cccgagggttacgaagcggcgaaacaccagcgcttcgtaggcaccggctacttcgaccag
gtgcagaacgtggtcaccagcggcaaggcctcgacccgggccctcgaacactccacggaa
gccgaacagttccacgctagcgaaacgcccgaaaagagcggcgtggcggccgactag

DBGET integrated database retrieval system