KEGG   Candidatus Koribacter versatilis: Acid345_4707Help
Entry
Acid345_4707      CDS       T00352                                 

Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00620  Pyruvate metabolism
aba00630  Glyoxylate and dicarboxylate metabolism
aba01100  Metabolic pathways
aba01110  Biosynthesis of secondary metabolites
aba01120  Microbial metabolism in diverse environments
aba01200  Carbon metabolism
Module
aba_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acid345_4707
   00630 Glyoxylate and dicarboxylate metabolism
    Acid345_4707
Enzymes [BR:aba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Acid345_4707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI Casc1
Motif
Other DBs
NCBI-ProteinID: ABF43707
JGI: Acid3454707
UniProt: Q1IHE3
Position
complement(5566723..5568297)
Genome map
AA seq 524 aa AA seqDB search
MVTTANLPTAVGFQLNTAPAGFNPKRDLAPGLYEFLETLHHEFTPRQQKLVAKRKRVLEA
SHRAELPEHMQPSEATQGNWRIELPKWCEDQRNQMTGPADEAELVGKMLNSGAPGVMLDL
EDSTVNQWDHQQLGMKNVLSALHGELTYYDQKRGKEVAIKESNVVIWTRARGMHLNQAGV
MPEVMSASLFDVGSLAYQVDTSKVKHNLCIYIPKSESAEEALWWRDLFEKIEDLRGWPKG
YIKCMALVESHPLAYQMEEFLYNLRDHILGLNLGRWDYMASLIHFNLEDPEFVLPDRNAI
PHDVLFFQNLRELIPEICHKRGALAIGGMTALYPSREDAELNARALDVLAKDKKNEANSL
MDGAWTGHPDQNQIAVDQFPKPNQLHARRANAQRYPDLRPAPKGVGKRTLNGTRAAVRTV
IRYRNGVLNGKGASLLDGYMEDLATDRIYRLMIAQRRKHSTVVPITDDDGHSVEHTAELV
TRLFDEELEKLIAKPGKDLGSPETFREARRIAEAMVKNGEFDPF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggttaccacggcgaatttaccaaccgcagtcgggttccagctgaacaccgcaccggcg
ggcttcaatccgaagcgcgacctcgcgcccgggctctacgaattcctcgaaacattgcat
cacgagttcacgccacgacagcaaaagttggtggcgaagcgtaaacgcgtgttggaagcg
tcgcatcgggccgagctgccggaacatatgcagccctcggaggccacgcagggtaactgg
cgcatcgagttgccgaagtggtgcgaagaccagcgcaaccagatgaccggtccggcggac
gaagcggagctcgtagggaagatgttgaactccggcgcgcccggggtgatgctcgatctg
gaagactccaccgtcaatcaatgggaccaccagcagctcggcatgaagaacgtgctgagc
gcgctgcacggcgagctcacgtactacgaccagaagcgtggcaaggaagtcgcgatcaaa
gagagcaacgtcgtcatctggacgcgcgctcgtggcatgcatttgaaccaggcaggcgta
atgccggaggtgatgtcggcctcgctgttcgacgtcggttcgctggcgtaccaggtggat
acgagcaaggtgaagcacaacctttgtatctacattccgaagagcgagagcgcggaagaa
gcgctatggtggcgcgatctgttcgagaagatcgaggacctgcgcggctggccgaagggc
tacatcaagtgcatggcgctggtggagtcgcatccgctggcgtaccagatggaagaattt
ctctacaacctgcgagatcacattctcgggttgaatctcggccgctgggattacatggcg
agcctgattcacttcaatctggaggatccggagtttgtgctgccggaccgcaacgcgatt
ccgcacgatgtgctgttcttccagaatttgcgcgagctgattccggaaatttgccacaag
cgcggagcgctggcgatcggcgggatgaccgcgttgtatccgagccgcgaagacgcggag
ttgaatgcgcgcgctctggacgtgctcgccaaagacaagaagaacgaagccaacagcctg
atggacggcgcgtggacagggcatcccgatcagaatcagatcgcggtggaccagtttccg
aagccgaaccaactgcacgcacggcgcgcgaacgcccagcggtatccggatttgcgtccg
gcgccgaagggcgtaggaaagcgcacgctcaatggcacgcgcgctgcggtacgcaccgtg
attcgctatcgcaatggcgtgctgaacggcaaaggcgcaagcctgctggatggctacatg
gaagatctggcgacggaccgcatctatcgcctgatgattgcgcaacggaggaaacattcg
actgtcgttccgattactgacgacgacggccactccgttgagcacactgctgaactcgtt
acccggctcttcgatgaggagttggaaaaactaatcgcgaagccaggaaaagacctgggc
tcgcccgaaaccttccgcgaagcaagacggatcgcggaagccatggtgaagaacggcgag
ttcgatccgttctag

DBGET integrated database retrieval system