KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_00024Help
Entry
BJAB0715_00024    CDS       T02727                                 

Definition
Protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abab  Acinetobacter baumannii BJAB0715
Brite
Enzymes [BR:abab01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BJAB0715_00024
Secretion system [BR:abab02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BJAB0715_00024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29623..30321
Genome map
AA seq 232 aa AA seqDB search
MIKKLGILALFSLTTSLSFANVDTVRENIKKQYPNLKISNIQKTEMPGLYSANLDQQIIY
LGEDGQHMFVGSMIRLKDQKNLTKDLVLGQNSIDWKQLPLKDAIKTVKGNGQHVLAVFSD
PNCPYCKQLEPELDKLKDVTIYTFIYPLKPQSIVVSRQVWCAPNQSYSWKKLIEQGVKPT
VASCTNPIDRNLELGKKLGFNGTPTLIFANGFKLVGARSAEEIQAVWKELGL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaattaggaatattggcgttatttagtttaactacaagtttgagtttcgct
aatgtagatactgttcgggaaaatattaaaaaacaatatcctaatttgaaaattagtaat
attcagaaaaccgaaatgcctggactatatagtgctaatctggaccagcaaattatttat
cttggtgaagatgggcagcacatgtttgtaggttctatgattcggttaaaagaccaaaag
aacttaactaaagatctggttttaggacagaactcaattgattggaaacagttgccttta
aaagatgctattaaaacagtcaaaggtaatggtcagcatgttttagcagtattttctgat
ccaaattgcccttattgtaaacagcttgagcctgaactcgacaagctgaaagatgtcact
atttacacttttatctatcctttaaaacctcagtctattgtggtttctagacaagtttgg
tgtgcaccgaatcaatcatattcatggaaaaaattaattgagcaaggtgttaaaccaacg
gttgcgagctgtacaaacccgattgaccgtaacttggaattagggaaaaaattaggtttt
aatggcacacctactctcatttttgctaacggatttaaactcgtcggagcgcgatctgcc
gaagaaattcaggcagtttggaaagagttaggtttataa

DBGET integrated database retrieval system