KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_01076Help
Entry
BJAB0715_01076    CDS       T02727                                 

Definition
Glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
abab  Acinetobacter baumannii BJAB0715
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abab00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BJAB0715_01076
   00330 Arginine and proline metabolism
    BJAB0715_01076
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BJAB0715_01076
Enzymes [BR:abab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BJAB0715_01076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1150963..1152285
Genome map
AA seq 440 aa AA seqDB search
MKTPLPDYLANVIEACDIDNSGHLADYIPELANANPNRLALAMSTVDGEIYSVGDDDVEF
TIQSISKPFVYAYVLQQLGIDAVLAKVGVEPSGEAFNEISLGKDGRPKNPMINSGAITVH
SLIQVKHGLHSAEILRRFMSELAGRELSFDESVYDSEVKTAYRNLSIGYMLRTVGILETD
PVDIVNGYIRQCAIMVTVKDLVRMGSVLANGGVDPKTGKRLLNRSVVRQVLSVMMSCGMY
DAAGDWLSTVGIPAKSGVAGGILGVLPGQVSIAAFSPRLDEHGHSVRGIDILERLSRDMG
LHLMEGTPSAQTIVQSHYRTGKDASLSVYVLRGVLKFTEAEMLLRILQDETTDQSTIVID
LTQISLIHDVGKRMFLEGVDRLIDDGHTLVLVDPEQRLDHARTAKDRELHVYHDFDDLLE
KHEIPAKKKTYSDIAALLNC
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccctctcccagattatttggcaaatgttatagaagcctgtgacatcgataac
agcggtcatctcgccgattatattcctgagttggccaatgcaaacccaaatcgattagct
ctagcaatgtctacggtagatggtgaaatttattcggtcggcgatgatgatgttgaattc
accatacaatcgatttctaaaccttttgtgtatgcttatgttttacaacaacttggcatt
gatgcggtacttgcgaaagtaggggtagagccttcgggagaagccttcaatgaaatttca
ttaggtaaagacggacgtccgaaaaacccgatgattaactctggcgcaattactgtacat
tccttgattcaggtcaagcatggtttacatagcgcagaaattctacgccgttttatgagc
gaacttgctggtcgtgaattaagttttgatgagtctgtttatgattcggaagtcaaaaca
gcctaccgtaatctttcgatcggttatatgttgcgaactgtggggattttagaaactgac
ccagtcgatattgtgaatggttacattcgtcaatgtgcgatcatggttacagttaaagac
ttggtacgtatgggcagtgtgcttgccaatggcggggtcgaccctaaaactggaaagcgt
ttgttaaaccgatctgtagttagacaagtactcagtgttatgatgagctgtggtatgtat
gatgccgcgggtgactggctttcaactgtcggtattcctgctaaaagtggtgtagcaggc
ggtattttgggtgtgctgccggggcaggtcagtattgctgctttttcacctcgactagat
gagcacggtcatagcgttcgaggaatcgatattttagagcgattatctcgtgacatggga
ttacatctcatggaaggtacgccttctgcacaaacgattgtacaaagtcattaccgtaca
ggaaaagatgcatcgttaagtgtgtatgtgcttcgaggggtattgaaatttaccgaagct
gaaatgttgttgcgtattttacaagacgagacaactgaccaaagcacaatcgtgattgat
ttaacccagatttcacttatccacgatgtgggtaaacgtatgttcttagaaggtgtagat
cgtctcattgatgatggtcatacccttgttttggttgatcctgaacagcgcctagatcat
gcgagaaccgccaaagatcgagaacttcatgtttatcatgatttcgatgatttgcttgaa
aagcatgagatccctgcaaaaaaaaagacttatagcgacatcgcagcacttctaaactgc
tga

DBGET integrated database retrieval system