KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_02224Help
Entry
BJAB0715_02224    CDS       T02727                                 

Definition
Kynureninase
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
abab  Acinetobacter baumannii BJAB0715
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abab00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    BJAB0715_02224
Enzymes [BR:abab01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BJAB0715_02224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2330690..2331676)
Genome map
AA seq 328 aa AA seqDB search
MITREQCLYWDQEDELKKFKDEFALPEGVIYLDGNSLGARPKKSLAVAQHIISQEWGEDL
INSWNKADWWGLPTRLGDKVAKLIGAEQGEVVISDSTTLNLFKVLSAAVKIQADNFPEHK
IIVAEKDAFPTDIYIIEGFIDLIQKGYQVELIDGVEDLSRALEKDAAVVVLSHVNYRTGY
FYDMASINEQIHSKDALVIWDLCHSVGAVPMHLNQTDSDFAIGCTYKYLNGGPGSPALLW
VNEKHRDQFWQPLSGWWSHKKPFDMAQHYEPANSIRRYLCGTQPVISMSLIECGVDIFLH
ADMQKIREKSLKLTDLFIQLVQQECSEF
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgattactcgtgaacagtgtttgtattgggatcaggaagatgaactcaaaaaatttaaa
gatgaatttgcattgccagaaggcgtcatttatttagatggtaactctttaggtgctaga
ccaaagaaatctttggctgtcgctcagcatattatttcccaagaatggggagaagatctg
atcaatagctggaataaggcagactggtgggggctaccaacacggctgggtgacaaagtc
gctaaactgattggtgcggaacaaggtgaagttgttatttcagattcaactacactgaac
ttatttaaagttttatctgcagcggtaaaaattcaggctgataatttccctgaacacaaa
attattgtggcagaaaaagatgcttttccaacagatatttacattattgaaggcttcatt
gacttaattcaaaagggctatcaggttgaattaattgatggcgtagaagacttatctcgt
gctttagagaaagatgctgctgtagtggtactttcccatgtgaattaccgcactggttat
ttttacgatatggcatctattaatgaacaaattcactctaaagatgctttggtgatttgg
gatttatgtcactcagtcggtgcggttcctatgcaccttaatcaaactgatagtgatttt
gcgattggttgtacctataaatatttaaatggtggccctggttctcctgcattgctctgg
gtcaatgaaaagcaccgtgatcagttctggcagcctttatctggttggtggagtcataaa
aaaccatttgatatggcacagcattatgagccagcgaatagtatccgccgatatttatgt
gggactcagccggttatttctatgagtctgattgaatgcggagtggatattttcctgcat
gctgatatgcaaaaaatccgtgagaaatcgttgaaattaactgatttatttattcaattg
gtacagcaagaatgttctgaattctga

DBGET integrated database retrieval system