KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_02683Help
Entry
BJAB0715_02683    CDS       T02727                                 

Definition
Membrane carboxypeptidase (penicillin-binding protein)
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
abab  Acinetobacter baumannii BJAB0715
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:abab00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJAB0715_02683
Enzymes [BR:abab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BJAB0715_02683
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     BJAB0715_02683
Glycosyltransferases [BR:abab01003]
 Polysaccharide
  Bacterial polysaccharide
   BJAB0715_02683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2762020..2764416
Genome map
AA seq 798 aa AA seqDB search
MKFERGIGFFALIFSILVIGAFIALSIYLIRLDNIIREKFEGQRWDIPAKVFARPLEIYN
NAPITQANFTQELKLLGYKTSSNYDKSGTYVAQGSNMYVHTRGFDYGDSVEPEQVLELSF
ANDQVVEVRSTKPSSTGVARLEPLLIGGIYPQHNEDRVLIKLNSVPKPLIEALISTEDRN
FYHHHGISIRGTARALVSNVTGGRRQGGSTLTQQLVKNFYLTPERTLKRKVNEALMALLI
ELHYSKDEILEAYLNEVNLGQNGNYSINGYGLASQFYFGLPLRELNVAQQAYLVGLVQGP
SLYNPWKNPEGAKNRRDTVLNNMRVMGYLTQAEYETEIARPLNVLSKPSLGPAKFPDFLD
IVRRQLRTEYQESDLTNQGLRIFTTLDPIAQTQVQNAFKASVERLANSNPARLKNLQGAV
LIAHPENGELIAAVGSTQDFTGFNRALDAKRQVGSLLKPVIYLSAIESGRYNWASQIEDA
PISVPVDGGKSWTPKNYSGGGHGIVSLSEALANSYNLSAVRLGQEFGLSTFTNNLRKFGV
ESTIPAYPSIFLGAVNMSPMEVLGIYENFATGGFKYPTRAIRSVVDANGRLLDRYGLNVQ
QTIDPSVGYIMNYGLQQVMSSGTGRAAYNSLSPALKLAGKSGTTNDTRDSWFAGYSGNHV
AVVWLGLDDNKVTGLTGSSGALPVWINVMKQLRQTPVNLRQPDSVQWQWIDRASGDLSAQ
ACDGAMYIPMLAHTVPHRATPCGAPYYQVDPTYTPQSDNTIPEPQDDNTDSYIRESENQM
EQDLSNNTRIISSGSYNN
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgaacgtggtatcggtttcttcgcgctaattttttccattttggtgattggt
gcttttattgctcttagtatctatctgattcgtttagataatattatacgtgaaaaattt
gaaggacagcgctgggacattccggccaaggtgtttgctcgacctttggaaatttataat
aatgcgccaattactcaagcaaatttcacccaagaattaaaattactaggttacaaaact
tcaagtaattatgacaagtctggaacctatgttgctcaaggcagcaacatgtatgtccat
acacgtggtttcgactatggtgacagcgtagaacctgaacaggttttagaactgagtttt
gcaaacgaccaagttgtagaagttcgcagtacaaaaccttcatcaactggggttgcccgt
ttagaacctttattaattgggggcatttatcctcaacataatgaagaccgcgttttgatt
aagcttaatagtgttcctaaaccacttattgaagctttaatttctacagaagaccgtaac
ttttatcatcaccacggtatttcaattcgtggtacagcacgtgctttggtaagtaatgta
actggaggacgtcgccaaggtggttcgaccctcacccaacagttagtcaaaaacttctat
ctaactcctgaacgcacacttaaacgtaaagttaatgaagcattaatggctttacttatt
gagttgcattacagcaaagatgaaattttagaagcatatttaaatgaagtgaatttaggc
caaaacggtaactattcaatcaatggttatggattggcctctcagttttatttcggttta
ccactacgtgagcttaatgttgcacaacaagcttatttagtcggtttggttcaaggtcca
tctttatataacccttggaaaaaccctgaaggggcaaaaaatcgccgcgatacagtatta
aataacatgcgtgtcatggggtatttaactcaagcagagtatgaaactgaaattgcgcgt
cctttaaatgttctaagcaaaccaagcctaggtccagcaaaattccctgactttttagat
attgtgcgtcgtcaattacgtaccgaatatcaggaaagtgatttaaccaatcaaggatta
cgtatttttacgaccttggacccaattgctcaaacacaagttcaaaacgcctttaaagct
tctgtagagcgcttagctaatagcaaccctgctcgcttgaaaaacctgcaaggggctgta
ctgattgcccatcctgaaaatggcgaattaattgcagctgtcgggtcaacgcaagacttt
actggttttaaccgtgccttagatgcaaaacgccaagtcggttctttattgaaacctgtc
atttatttgagcgcaattgaatctggacgttataactgggcaagccagattgaagacgct
ccaattagcgttccagtagacggcggtaaaagctggacaccgaagaactatagcggcggt
ggacatggaattgtgagtttaagtgaagccttagcaaattcttataacctttctgctgtg
cgcttaggtcaagagttcgggttatctacatttaccaataacttaagaaaatttggtgtt
gaatcgacaatcccggcctacccttctattttccttggtgcagttaatatgtcaccaatg
gaagtacttggtatttatgaaaactttgctacaggcggtttcaaatatccgactcgtgcg
attcgttctgttgtagatgcaaatggacgtttacttgatcgttatggtctaaacgtacaa
caaaccattgatccatctgtcggttatatcatgaactatggtttacaacaggtcatgtca
tcaggtacaggacgtgcagcctataacagcttatctccagctttaaaattagcgggtaaa
tcaggtacgactaacgatacacgtgactcatggtttgccggctattcaggtaatcatgtt
gcagtagtatggttaggtttagatgataataaagtaactggtttaacaggttcatctggt
gcattaccagtatggattaatgtgatgaaacaattacgccagacaccagtaaacttacgt
caaccagactctgtacaatggcaatggattgaccgtgcatcgggtgacttatcggcacag
gcttgtgatggtgccatgtatattccaatgctagcgcatacagtcccacatcgtgctacg
ccatgtggagcaccgtattatcaagttgatccaacatatacgccacaaagtgataacaca
attcctgagcctcaggatgataataccgacagttatattcgtgaaagtgaaaaccagatg
gaacaagatctgtcgaataacacacgaatcatttcaagtggtagttataacaactaa

DBGET integrated database retrieval system