KEGG   Acinetobacter baumannii BJAB0715: BJAB0715_03280Help
Entry
BJAB0715_03280    CDS       T02727                                 

Definition
Fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
abab  Acinetobacter baumannii BJAB0715
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:abab01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:abab01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3418710..3419882
Genome map
AA seq 390 aa AA seqDB search
MTSAPLKAPINWTASITLIGLPILAAIIIPIYAYYYDFSVSAWVSLFFLLALSSMGITAG
YHRLWAHRAYEASLPLKILLMIGGTFAVQNSILFWASGHRTHHRHVDDVDEDPYSIERGF
WYAHMGWMIRDHSPSEPDFKNAPDLLNDKLVMFQHKYYALMVVAVHVGILGLVGWATGDL
WGVVLLGGLLRLIISHQVTFFINSLCHMFGKRPYTDENSARDNFWLAIATWGEGYHNYHH
IFQYDYRNGVKWWQYDPTKWLIWTCSKIGLAKNLRRIPSFNIKKAELAMKFKYAEQDLAI
YGHDVNADISQMKQRIAQEYEAFTHTLNDWAKLKEQELQAKKAAMAEKIHKMDHKLKVDF
QLLEHRLSHHRECLETLMRNIKKNTNVVPD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgccccactcaaggccccaattaactggaccgctagcattaccttaattggt
ttaccaattcttgctgcaatcataatcccgatttatgcgtattattatgattttagtgta
agcgcatgggtaagcttattttttcttttagctttaagtagcatggggattactgctggt
taccatcgtctttgggcacaccgtgcttatgaagcgtcgttaccacttaaaattctttta
atgattggcggcacatttgctgtacaaaacagtattctgttttgggcatctggtcaccgt
acccatcaccgtcatgtcgacgatgtagatgaagatccatattcaattgaacgtggcttt
tggtatgcccatatgggttggatgatccgcgatcattctccatctgaaccagattttaaa
aatgcaccagacttgctcaatgacaaactggtgatgttccagcataaatactatgccttg
atggtcgtagcagttcacgttggtattttaggtttggttggctgggcaactggcgattta
tggggtgttgtacttcttggtggcctattacgtttaatcattagtcatcaagttacattc
ttcatcaactcactttgccacatgttcggtaaacgtccttataccgatgaaaactcagca
cgtgataacttctggttagcgattgcaacttggggtgagggttaccacaactatcaccat
attttccagtacgattatcgtaatggtgtgaaatggtggcaatatgatccaacaaaatgg
ctcatttggacatgctctaagatcggtttagcaaagaacctacgtcgtattccaagcttt
aatattaaaaaagcagaattggcaatgaagtttaaatatgctgaacaagacttggctatt
tatggtcatgatgtaaatgccgatattagtcaaatgaagcaacgtattgctcaagagtat
gaagcatttacgcatactttaaatgactgggcgaaactcaaagaacaagagttacaagca
aagaaagcagcaatggctgaaaagattcacaaaatggatcacaagttaaaagttgatttc
caattgcttgaacatcgtttgagtcatcaccgtgagtgtttagaaactttaatgcgtaac
attaaaaagaacacaaacgtcgtaccagactaa

DBGET integrated database retrieval system