KEGG   Acinetobacter baumannii D1279779: ABD1_02000Help
Entry
ABD1_02000        CDS       T02491                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
abad  Acinetobacter baumannii D1279779
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:abad00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(233745..234521)
Genome map
AA seq 258 aa AA seqDB search
MKTASVNKHDLMQHAQQDMQKWISDLDLTDRQKLALTCRILFDHGHDAGLAGQITCRSEN
KETFITQRFGLGFDEITASNLLEVNQDLEPINQEGMANPANRFHTWIYKEHPEVNCIIHT
HPTYVAALSMLQIPLMISQMDVCALYEDCSFVGHWPGVPVGNEEGILISSALGKNRAVLL
SHHGQLVTGKTIEEACNLALLIERAAQLQLLAMSAGQIQPIPHALAAEAHDWVSTDKRNK
VNFAYYARKALKKHSDCI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgcttctgtaaacaaacacgacttgatgcaacacgcacagcaagacatgcaa
aagtggattagcgacttagatttaacagaccgtcaaaagcttgcactgacttgccgtatt
ttatttgatcatgggcatgacgctggtttagcgggtcaaattacatgccgtagtgaaaat
aaagaaacctttattactcaacgtttcggtttaggttttgatgaaattactgcttcaaac
ttgcttgaggtgaatcaggacttagaacccatcaatcaagaaggcatggcaaacccagcc
aaccgtttccacacatggatttataaagaacatccagaagtgaactgtattatccatacg
catccaacgtatgtagcggccctgtcaatgctacagattccacttatgatttcccaaatg
gacgtctgcgcactttacgaagactgctcatttgtaggtcattggccgggagttcctgta
gggaatgaagaaggtattttgatttcttctgctctgggtaaaaaccgcgctgttttgttg
tctcaccacggtcaactggtcacaggaaaaactatcgaagaagcctgtaacttggctctt
ttaattgaacgcgcagctcaactgcaacttttagccatgtctgctggacaaatccagcct
atcccccacgctttggcagcagaagcccatgattgggtgtctactgataaacgcaacaaa
gtgaactttgcttactacgcacgtaaagctttgaaaaaacattctgactgtatttaa

DBGET integrated database retrieval system