KEGG   Acinetobacter baumannii D1279779: ABD1_02240Help
Entry
ABD1_02240        CDS       T02491                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abad  Acinetobacter baumannii D1279779
Brite
Enzymes [BR:abad01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ABD1_02240 (dsbC)
Secretion system [BR:abad02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ABD1_02240 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(259535..260350)
Genome map
AA seq 271 aa AA seqDB search
MSFTRSQIFLACALASSLLFSACSKENKPQKEDALTATAPATGEASTIIERNAKQRLIET
LQKQFKNANINVKILDIKPTEVPNLYWVNLEGMTSVYTTSDGKYLIQGDVIRLGGKELHN
IGDSLQASENKKHLAALKNEDLIVYPAKGGKAKHVIYVFTDASCPYCHKLHEHLAEINEK
GIEVRYIAWPRGEQFMPTMEAVWCSADRKAAFDQAVQGISIPPAQCKNPVREQYQLGLNM
GVNGTPAIYNVDGEYLGGYLTPDELIKRLDK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttacccgatctcaaatttttcttgcctgtgctttggcttctagcctgttgttc
agtgcttgttctaaagaaaacaaaccacaaaaagaagatgcgctcacagcgaccgcacct
gctacaggggaagcttcaaccattattgaacgcaatgctaaacagcgtttaattgaaact
ttgcaaaaacaatttaagaatgcaaatatcaacgtcaagattttagatattaagcctacc
gaagttcctaatttatattgggttaaccttgaaggaatgacgtcggtttatacaacaagt
gatggtaaatacctgattcaaggcgatgtcatccgtttaggcggtaaagaacttcataat
atcggcgatagccttcaagcctcagaaaacaaaaagcatcttgctgctttaaaaaatgaa
gacttaattgtttatccagctaagggcggtaaagctaaacatgtgatttatgtgtttacc
gatgcaagctgtccttactgccataaattacatgagcatttagctgagattaatgagaaa
ggcattgaggttcgttacattgcatggccacgcggcgaacagtttatgccaactatggaa
gcggtttggtgtagtgcagaccgtaaagctgcatttgaccaagctgtacagggcattagt
attccacctgctcaatgtaaaaaccctgttcgcgaacaataccaacttggtctaaacatg
ggcgtaaatggtacaccagctatttataatgttgatggtgagtacttgggtggctactta
accccagatgaattgattaaacgattggataaataa

DBGET integrated database retrieval system