KEGG   Acinetobacter baumannii D1279779: ABD1_27700Help
Entry
ABD1_27700        CDS       T02491                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abad  Acinetobacter baumannii D1279779
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3026092..3026802
Genome map
AA seq 236 aa AA seqDB search
MKTKLATLMLSLAFFGSAHADVKTLEQNLKTNYPDLPVKGVYQSPVAGIYEVYTSGRIVY
TNQDAKYFFVGNLVDIKQQKNMTEERIAELGKIDVKSLPLNQAIKYVKGKGERTLYIFSD
PDCPYCQRLEQNMVGVDNVTVYVFLYPLTSLHPNAEKVSNQIWCSKNPSEAWTNYMLNRK
LPAAGKSCTSPIQKNIALGQKLNIDGTPTLFLQDGQRISGVPSDAKQIEALLQSVK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaaacttgctacactcatgttgagtttggcttttttcggttctgctcatgct
gatgttaaaacacttgaacaaaatctgaagacaaattatccagacctccctgtaaaaggt
gtctatcagtcacctgtcgctggaatttatgaagtctatacaagtggccgtattgtttat
accaatcaagatgcaaaatacttttttgtaggcaatttagttgatatcaaacaacaaaaa
aatatgacagaagagcgaattgccgaattgggtaaaattgatgttaaaagtctcccatta
aatcaggcaattaaatacgtcaaaggtaaaggagagcgtactctttatattttcagtgac
cctgattgcccttactgtcagcgtctagaacaaaatatggttggggtggataacgtaacg
gtatatgtattcttatatccgctgaccagcttacatccaaatgctgaaaaggtttctaat
caaatctggtgctctaaaaacccttcagaagcttggacaaattatatgcttaaccgtaaa
ttgccagcggctggcaaaagctgtacaagtccaattcagaaaaatattgctttaggccag
aaattaaatatagatggcacaccaactctgttcttacaagatggtcaaagaatctctggc
gtaccaagtgatgcaaaacagattgaagcattattacagtcagtaaaataa

DBGET integrated database retrieval system