KEGG   Acinetobacter baumannii D1279779: ABD1_33920Help
Entry
ABD1_33920        CDS       T02491                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abad  Acinetobacter baumannii D1279779
Brite
Enzymes [BR:abad01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ABD1_33920
Secretion system [BR:abad02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ABD1_33920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3697823..3698521)
Genome map
AA seq 232 aa AA seqDB search
MIKKLGILALFSLTTSLSFANVDTVRENIKKQYPNLKISNIQKTEMPGLYSANLDQQIIY
LGEDGQHMFVGSMIRLKDQKNLTKDLVLGQNSIDWKQLPLKDAIKTVKGNGQHVLAVFSD
PNCPYCKQLEPELDKLKDVTIYTFIYPLKPQSIVVSRQVWCAPNQSYSWKKLIEQGVKPM
VASCTNPIDRNLELGKKLGFNGTPTLIFANGFKLVGARSAEEIQAVWKELGL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaattaggaatattggcgttatttagtttaactacaagtttgagtttcgct
aatgtagatactgttcgggaaaatattaaaaaacaatatcctaatttgaaaattagtaat
attcagaaaaccgaaatgcctgggctatatagtgctaatctggatcagcaaattatttat
cttggtgaagatgggcagcacatgtttgtaggctctatgattcggttaaaagaccagaag
aacttaactaaagatctggttttagggcagaactcaattgattggaaacagttgccttta
aaagatgccattaaaacagtcaaaggtaatggtcagcatgttttagcagtattttctgat
ccaaattgcccttattgtaagcagcttgaacctgaactcgacaagcttaaagatgtcact
atttacacttttatttatcctttaaaacctcagtctattgtggtttctagacaagtttgg
tgtgcaccgaatcaatcatattcatggaaaaaattaattgagcaaggtgttaaaccaatg
gttgcgagctgtacaaacccgattgaccgtaacttggaattagggaaaaaattaggtttt
aatggcacacctactctcatttttgctaacggatttaaactcgtcggagcgcgctctgct
gaagaaattcaggcagtttggaaagagttaggtttataa

DBGET integrated database retrieval system