KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_01471Help
Entry
BJAB0868_01471    CDS       T02728                                 

Definition
Catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
abaj  Acinetobacter baumannii BJAB0868
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abaj00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BJAB0868_01471
  Amino acid metabolism
   00380 Tryptophan metabolism
    BJAB0868_01471
Enzymes [BR:abaj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BJAB0868_01471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1555812..1556876
Genome map
AA seq 354 aa AA seqDB search
MNNLNFKTLKKYWLRFVGIAVIAGALVLAFAWTAGLFGHRTTSKTFLGDTLKNFDPGYRR
AHGKGICFDGTYHSNGAAAALSKATVFAKSDIPAIGRFSIGSGNPHAADNSTATVSMALL
LSPADHSQWRMKLNNFPYFPTRNAEGFLAQQKAFKPVPSTGKPDPALVEAFLKEYPEARK
SIEQKAKMPLTGSFSGAEFYVVNAFILRAANGQEQPVRWSMRPHSKFISLTKEQRDQADH
DFLFKDIKKRLAEGPLYWDLVLQLAEPGDPVNDPSQPWPKDRKEVIAGTLEVKNVTDQVN
GACRDINFDPTLVPPGIELSDDPVLAARAAIYSQSYNARLREIGFGKATDAVGK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaataatttgaattttaaaacgctaaagaagtactggctgcgattcgtgggtattgct
gtaatcgcaggcgctttagtattggcatttgcttggaccgctggtctatttggacatcga
acaacatccaaaacttttttgggtgacacattaaagaactttgatcccggatatcgacga
gcacatggtaaaggtatttgttttgatggcacttaccatagtaatggtgcggcagcagca
ctctctaaagccactgtatttgccaagtctgatataccagcaattggccgattttctatt
ggaagcggtaacccgcatgcggcagataattctaccgcaacagtgagtatggctttatta
ctttctccagccgatcattcgcagtggcgcatgaaattaaacaactttccttatttcccg
actcgaaatgctgaaggttttttggcgcagcaaaaagcatttaaaccagttccgtctact
gggaaacctgatccagcccttgttgaggcgtttttaaaagaatatcccgaagcgcgtaag
tctattgagcaaaaggccaagatgccattaactggtagtttcagcggtgcagaattttat
gtcgtaaatgcctttatattgcgggcagccaatggacaagaacagccagtccgttggtct
atgcgtcctcattcaaaatttattagtctgacgaaagaacaacgtgatcaagctgatcat
gatttcttatttaaagacatcaaaaaacgtttggctgaagggccgctctattgggactta
gtattgcaacttgccgagccaggagacccagtgaatgacccatctcagccttggccaaaa
gaccgtaaagaagttatagccggaacattagaagtcaaaaatgtaactgatcaggtaaat
ggcgcttgtcgtgatattaactttgacccaactttggtgccacccggaattgagttatca
gatgacccagtactcgcagcacgagcggcgatctattcacagtcttataatgctcgatta
cgtgaaattggatttggcaaagcaacggatgccgtgggcaaatag

DBGET integrated database retrieval system