KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_02213Help
Entry
BJAB0868_02213    CDS       T02728                                 

Definition
Kynureninase
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
abaj  Acinetobacter baumannii BJAB0868
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abaj00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    BJAB0868_02213
Enzymes [BR:abaj01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BJAB0868_02213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2321532..2322782)
Genome map
AA seq 416 aa AA seqDB search
MITREQCLYWDQEDELKKFKDEFALPEGVIYLDGNSLGARPKKSLAVAQHIISQEWGEDL
INSWNKADWWGLPTRLGDKVAKLIGAEQGEVVISDSTTLNLFKVLSAAVKIQADKFPEHK
IIVAEKDAFPTDIYIIEGFIDLIQKGYQVELIDGVEDLSRALEKDVAVVVLSHVNYRTGY
FYDMATINEQIHSKDALVIWDLCHSVGAVPMHLNQTDSDFAIGCTYKYLNGGPGSPALLW
VNEKHRDQFWQPLSGWWSHKKPFDMAQHYEPANSIRRYLCGTQPVISMSLIECGVDIFLH
ADMQKIREKSLKLTDLFIQLVHQECSEFGFELITPLDHNHRGSHVSYRHEFGYEIIQALI
ARGVIGDYREPAVLRFGITPLYLGFEDIWNAVQHLKETMLNSEWKNKQYLVRGEVT
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgattactcgtgaacagtgtttgtattgggatcaggaagatgaactcaaaaaatttaaa
gatgaatttgcattgccagaaggcgttatttatttagatggtaactctttaggtgctaga
ccaaagaaatctttggctgtcgctcagcatattatttcccaagaatggggagaagatctg
atcaatagctggaataaggcagattggtgggggctaccaacgcggctgggtgacaaagtc
gctaaactgattggtgcggaacaaggtgaagttgttatttcagattcaactacactgaac
ttatttaaagttttatctgcagcggtaaaaattcaggctgataaattccctgaacacaaa
attattgtggcagaaaaagatgcttttccaacagatatttacattattgaaggtttcatt
gacttaattcaaaagggctatcaggttgaattaattgatggcgtagaagacttatctcgt
gctttagagaaagatgttgctgtagtagtactttcccatgtgaattaccgcactggttat
ttttatgatatggcaactattaatgaacaaattcactctaaagatgctttggtgatttgg
gatttatgccactcagtcggtgcggttcctatgcaccttaatcaaactgatagtgatttt
gcgattggttgtacctataaatatttaaatggtggccctggttctcctgcattgctctgg
gtcaatgaaaagcatcgtgatcagttctggcagcctttatctggttggtggagtcataaa
aaaccatttgatatggcacagcattatgagccagcgaatagtatccgccgatatttatgt
gggactcagccggttatttctatgagtctgattgaatgcggagtagatattttcctgcat
gccgatatgcaaaaaatccgtgagaaatcgttgaaattaacagatttatttattcaattg
gtacatcaagaatgttctgaattcggatttgagttaattacgcctttagatcataaccat
cgtggtagtcatgttagttatcgtcatgaattcggttatgaaattattcaggcacttatt
gcacgcggtgtgattggtgattatcgggaacctgcagtcttgagatttggtattacacct
ttgtatctgggctttgaagatatttggaatgcagtacagcacttaaaagaaaccatgctg
aatagtgaatggaaaaacaaacagtatttagttcgtggtgaagtgacctga

DBGET integrated database retrieval system