KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_03381Help
Entry
BJAB0868_03381    CDS       T02728                                 

Definition
Glutamate dehydrogenase/leucine dehydrogenase
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
abaj  Acinetobacter baumannii BJAB0868
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abaj00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BJAB0868_03381
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BJAB0868_03381
   00330 Arginine and proline metabolism
    BJAB0868_03381
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BJAB0868_03381
Enzymes [BR:abaj01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     BJAB0868_03381
Exosome [BR:abaj04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BJAB0868_03381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3557241..3558512)
Genome map
AA seq 423 aa AA seqDB search
MSDLSYVNEHSDAWQTYLAQIDRVAPYLEHLADYIDTLKRPKRALIVDVPIVMDDGSIQH
FEGYRVQHNLSRGPGKGGVRYHPNVDLNEVMALSAWMTIKTAVLNLPFGGAKGGIRVDPR
KLSNRELERLTRRYTTEIGHIIGPQKDIPAPDVGTNANIMGWMMDTYSTSQGHTVTGVVT
GKPVHLGGSLGRVKATGRGVFVTGREVAAKINLPIEGAKVAVQGFGNVGSEAAFLFVESK
AKITHVQDHTGTIFNADGIDLVALRDHVNANQGVGGFAGAQAIADEDFWTAEVDIIIPAA
LEGQITVERAEKLKAKLILEGANGPTYPKAEDVLVERGIVVVPDVVCNAGGVTVSYFEWV
QDMASYFWSEEEINERLDKLMVQAMDDVWNTANKNACTLRTAAYILACERILKARKERGI
FPG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatctttcatacgtaaacgaacatagcgatgcatggcaaacttacttggctcaa
attgaccgtgtagcgccatacttagaacatttagctgattatatcgatactttaaaacgt
cctaagcgtgcgcttattgtggacgtgccaattgtaatggacgacggttcaatccagcac
tttgaaggctaccgtgtacaacacaacttgtctcgtggtcctggtaaaggtggtgttcgt
taccatccaaatgttgacttaaatgaagtgatggcattgtctgcatggatgacaattaaa
actgcagttttgaacttgccatttggtggtgcaaaaggtggtatccgtgttgacccacgt
aaattatcaaatcgtgaattagagcgtttaactcgccgttatacgactgaaattggtcac
attatcggacctcaaaaagacattcctgctccagacgttggtacaaatgccaatattatg
ggttggatgatggatacttattctactagccaaggtcacacagtgacgggtgttgtaact
ggtaaaccagttcacttaggcggctctttaggtcgtgtgaaagcaactggtcgcggtgta
ttcgttactggtcgtgaagttgctgcaaaaatcaacttaccaattgaaggcgcaaaagtt
gctgttcaaggttttggtaatgtaggtagtgaagctgctttcttatttgttgaatcaaaa
gcaaaaatcactcacgttcaagaccacactggcacaattttcaatgctgatggtattgat
cttgttgcgctacgtgatcacgtaaatgcaaaccaaggtgttggtggttttgctggtgca
caagcaattgcagatgaagatttctggactgcagaagtagacatcattattcctgctgca
ttagaaggccaaattacagttgagcgtgctgaaaaacttaaagctaagttgattttagaa
ggcgcgaacggcccgacttatcctaaagctgaagatgtattggttgagcgtggcattgtt
gtagttcctgacgtggtatgtaacgccggcggtgtaactgtaagttacttcgaatgggtt
caagacatggcgagctacttctggagcgaagaagaaatcaacgagcgtttagacaagttg
atggttcaagcaatggatgacgtttggaatacagcgaacaagaatgcttgtactttacgt
acagcagcttacatcttggcatgtgagcgtatcttaaaagctcgtaaagaacgcggtatt
ttcccaggctaa

DBGET integrated database retrieval system