KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_p0061Help
Entry
BJAB0868_p0061    CDS       T02728                                 

Definition
Protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abaj  Acinetobacter baumannii BJAB0868
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p2BJAB0868:complement(42678..43415)
Genome map
AA seq 245 aa AA seqDB search
MNKLNLSIGILLAIATSLTHATKTDDVKAKVLQNYPATTVSQVNETPLKNIFEVVMGKNV
AYTDEEARYFIFGNLFDMKTQTDLTTTPSNKIEIGFPSKERLKDAVKTVKGNGKRKLAVF
SDPDCPYCQQLEHNLQSITDVTIYTFLFPLESLHPRAKGTAISIWCAKDQSKAYHEYMLN
NKQPQVKSCENPIDRNIQFGGSMGIQGTPSVIFEDGSLIPGAISAPELERQLQEANKKVN
GGISK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattaaatctatctatcggtatcttattagcaattgcaacatcactaactcat
gcaactaagactgatgatgttaaagccaaagtgttacaaaactatccagcaacaacagta
tctcaagtaaacgaaacgccactgaagaatatctttgaagtcgttatgggtaaaaatgtt
gcctatacggacgaagaagcaagatattttatctttggcaacttgtttgacatgaagaca
cagactgatttaacaactactcctagcaataaaattgaaatagggttcccatctaaagaa
cgtctaaaagatgccgtcaaaactgttaaagggaatggaaaaagaaaattagctgttttc
agtgatccagattgcccgtattgccaacagcttgagcataacctgcaatcaattactgat
gtaacaatttacacgttccttttccctcttgagagcttacatccgcgtgctaaaggaact
gcaatttcaatatggtgcgctaaagatcaatcaaaagcctatcacgaatacatgcttaac
aataagcaacctcaagttaagtcatgtgaaaacccaattgatcgcaatattcagtttggg
ggaagtatgggaattcaaggcacacctagtgtgatctttgaagatggatctctcatccct
ggcgctattagtgcacctgaattagaacgtcaattgcaggaagcaaataagaaagtaaat
ggagggataagcaaatga

DBGET integrated database retrieval system