KEGG   Acinetobacter baumannii AB030: IX87_03505Help
Entry
IX87_03505        CDS       T03375                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abau  Acinetobacter baumannii AB030
Pathway
abau00071  Fatty acid degradation
abau00072  Synthesis and degradation of ketone bodies
abau00280  Valine, leucine and isoleucine degradation
abau00310  Lysine degradation
abau00362  Benzoate degradation
abau00380  Tryptophan metabolism
abau00620  Pyruvate metabolism
abau00630  Glyoxylate and dicarboxylate metabolism
abau00640  Propanoate metabolism
abau00650  Butanoate metabolism
abau00900  Terpenoid backbone biosynthesis
abau01100  Metabolic pathways
abau01110  Biosynthesis of secondary metabolites
abau01120  Microbial metabolism in diverse environments
abau01130  Biosynthesis of antibiotics
abau01200  Carbon metabolism
abau01212  Fatty acid metabolism
abau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abau00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IX87_03505
   00630 Glyoxylate and dicarboxylate metabolism
    IX87_03505
   00640 Propanoate metabolism
    IX87_03505
   00650 Butanoate metabolism
    IX87_03505
  Lipid metabolism
   00071 Fatty acid degradation
    IX87_03505
   00072 Synthesis and degradation of ketone bodies
    IX87_03505
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IX87_03505
   00310 Lysine degradation
    IX87_03505
   00380 Tryptophan metabolism
    IX87_03505
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IX87_03505
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IX87_03505
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    IX87_03505
Enzymes [BR:abau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IX87_03505
Exosome [BR:abau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IX87_03505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: AIL77731
UniProt: A0A0E1FIY2
Position
644274..645479
Genome map
AA seq 401 aa AA seqDB search
MLNAYIYDGLRSPFGRHAGELASIRPDDLAATVIQKLLEKTGVPGADIEDVILGDTNQAG
EDSRNVARNALLLAGLPVTVPGQTVNRLCASGLGAVIDSARAITCGEGELYIAGGVESMS
RAPFVMGKAESAYSRDAKIYDTTIGSRFPNKKIIAQYGGHSMPETGDNVAAEFGISREQA
DLFAAQSQAKYQKAKEEGFFVDEITPIEVFQGKKLPPKLVSEDEHPRPSSTVEALTKLKP
LFEGGVVTAGNASGINDGAAALLIGSEAAGQKYGLKPMAKILSAAAAGIEPRIMGAGPIK
AIKKAVARAGLTLDDMDIIEINEAFASQVLSCLKGLNVDFNDPRVNPNGGAIAVGHPLGA
SGARLALTVARELIRRKKKYAVVSLCIGVGQGLAMVIENVS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgcatatatctatgatggtttacgtagtccatttggtcgtcatgcaggtgaa
cttgcctcaattcgccctgatgatttagccgcaactgtcattcaaaaactactagaaaaa
actggtgtgccgggtgcggatattgaagatgtgatcttaggcgacaccaaccaagcgggt
gaagatagtcgtaatgtggcacgaaatgcattattacttgcaggtctacctgttactgta
ccgggccagacagtaaaccgtctatgtgcgagtggtttaggcgctgtgattgactcagca
cgtgccattacttgtggtgaaggcgaactgtatattgcaggtggtgtagaaagtatgtca
cgtgctcccttcgtgatgggtaaagcggaaagtgcttatagccgtgatgcaaaaatttat
gacaccaccattggatctcgttttccaaataaaaaaattattgctcagtacggcggtcat
tcaatgcctgaaacgggcgataacgttgcagccgagtttgggattagccgtgaacaagcc
gacttatttgcagcccaatcacaagccaaatatcaaaaagccaaagaagaaggtttcttt
gtcgatgaaattacaccaattgaggttttccaaggcaaaaaattgccccctaaactcgtt
tcagaagatgaacacccccgcccaagctcaactgttgaagcactcacaaagttaaaacca
ctgtttgaaggtggcgtggttacagctggtaatgcctcaggtattaatgatggtgcagca
gcacttttgattggttcagaagctgcaggtcaaaaatatggcctaaaaccaatggcaaaa
atcttgtcagcagcagctgcgggtattgagccacgcattatgggtgcaggtccgatcaaa
gccattaaaaaagcggttgcacgtgctggccttactttagatgacatggatattatcgaa
attaatgaagcctttgcttcacaggttttatcttgtttaaaaggtttaaatgttgatttt
aatgatccacgtgtgaacccgaacggtggtgcgattgctgttggtcatccacttggtgct
tcaggcgctcgtcttgcgttaacagtagcgcgcgagttaattcgccgtaagaagaaatat
gccgtggtgagcctatgtattggtgtaggtcaaggtcttgcgatggtgattgaaaacgtt
tcataa

DBGET integrated database retrieval system