KEGG   Acinetobacter baumannii ZW85-1: P795_12900Help
Entry
P795_12900        CDS       T02954                                 

Definition
hypothetical protein
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
abaz  Acinetobacter baumannii ZW85-1
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abaz00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    P795_12900
   00330 Arginine and proline metabolism
    P795_12900
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    P795_12900
Enzymes [BR:abaz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     P795_12900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2784110..2785432)
Genome map
AA seq 440 aa AA seqDB search
MKTPLPDYLANVIEACDIDNSGHLADYIPELANANPNRLALAMSTVDGEIYSVGDDDVEF
TIQSISKPFVYAYVLQQLGIDAVLAKVGVEPSGEAFNEISLGKDGRPKNPMINSGAITVH
SLIQVKHGLHSAEILRRFMSELAGRELSFDESVYDSEVKTAYRNLSIGYMLRTVGILETD
PVDIVNGYIRQCAIMVTVKDLVRMGSVLANGGVDPKTGKRLLNRSVVRQVLSVMMSCGMY
DAAGDWLSTVGIPAKSGVAGGILGVLPGQVSIAAFSPRLDEHGHSVRGIDILERLSRDMG
LHLMEGTPSAQTIVQSHYRTGKDASLSVYVLRGVLKFTEAEMLLRILQDETTDQSTIVID
LTQISLIHDVGKRMFLEGVDRLIDDGHTLVLVDPEQRLDHARTAKDRELHVYHDFDDLLE
KHEIPAKKKTYSDIAALLNC
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccctctcccagattatttggcaaatgttatagaagcctgtgacatcgataac
agcggtcatctcgccgattatattcctgagttggcaaatgcaaacccaaatcgattagct
ttagcaatgtctacggtagatggtgaaatttattcggtcggcgatgatgatgttgaattc
accatacaatcgatttctaaaccttttgtgtatgcttatgttttacaacaacttggtatt
gatgcagttcttgcgaaagtaggggtagagccttcgggggaagccttcaatgaaatttca
ttgggtaaagatggtcgtccaaaaaatccgatgattaactctggtgcaattactgtacat
tccttgattcaggtcaaacatggtttgcatagtgcagaaattctacgacgttttatgagc
gagcttgctggtcgcgaattaagttttgatgagtctgtttatgattcggaagtcaaaaca
gcctaccgtaatctttcgatcggttatatgttgcgcacggtggggattttggaaactgac
cctgtcgatattgtgaatggttacattcgtcaatgtgcgatcatggttacagttaaagat
ttagtacgcatgggcagtgtgcttgccaatggcggggtcgaccctaaaactggaaaacga
ttactgaaccgatctgtagttagacaagtactcagtgtcatgatgagctgtggtatgtat
gatgccgcgggtgactggctttcaactgtcggtattcctgctaaaagtggtgtagcaggc
ggtattttgggtgtgctgccgggtcaagttagtattgctgctttttcacctcgactagat
gagcacggtcatagtgttcgaggtatcgatattttagaacgattatctcgtgacatgggg
ttacatctcatggaaggtacaccttctgcacaaacgattgtacaaagtcattaccgcaca
ggaaaagatgcatcgttaagtgtgtatgtgcttcgaggcgtattgaaatttaccgaagct
gaaatgttgttgcgtattttacaagacgagacaacggaccaaagcacaatcgtgattgat
ttaacccagatttcacttatccacgatgtgggtaaacgtatgttcttagaaggtgtagat
cgtctgattgatgatggccatactcttgttttagtcgatcctgagcaacgattagatcat
gcaagaacagctaaagatcgagaacttcatgtttatcatgatttcgatgatttgcttgaa
aagcatgagatccctgcaaaaaaaaagacttatagcgacatcgcagcacttctaaactgc
tga

DBGET integrated database retrieval system