KEGG   Acinetobacter baumannii ZW85-1: P795_9880Help
Entry
P795_9880         CDS       T02954                                 

Definition
aminotransferase AlaT
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
abaz  Acinetobacter baumannii ZW85-1
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abaz00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    P795_9880
   01230 Biosynthesis of amino acids
    P795_9880
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    P795_9880
   00290 Valine, leucine and isoleucine biosynthesis
    P795_9880
Enzymes [BR:abaz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     P795_9880
    2.6.1.66  valine---pyruvate transaminase
     P795_9880
Amino acid related enzymes [BR:abaz01007]
 Aminotransferase (transaminase)
  Class I
   P795_9880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2144422..2145852
Genome map
AA seq 476 aa AA seqDB search
MSQKKSVLFQQLLPVIKQYQQSGFTHEKIVELLKDQHDLNLVTVKTFKSYLYRYAKVNPA
MSKNTATLQSMPTSREIKKSSKLEHVCYDIRGPVLRAANEMEEQGHKIIKLNIGNPAPFG
FEAPQEIINDVALNLPNAIGYVDSKGIFPARKAICQYYQQKGILNMHVNDVYIGNGVSEL
IVMAMQGLLDDGDEMLIPMPDYPLWTAAVNLSGGTAIHYKCDEENSWYPDIADIESKITS
NTRGIVIINPNNPTGSVYPRHVLEQIVALAKKHDLILFADEIYDKIVYDGIEHVAVASLA
GDQLCISFNGLSKAYRIAGFRSGWMAITGDKSRAADYIEGLDMLASMRLCANVQAQYAIQ
TALGGYQSINDLIRPGGRLYEQRNIAWEMLNEIPGVSCVKPEGAMYCFPRLDPNIYPIED
DEKLMLDLLRAEKVLLVQGTGFNWPTPDHFRVVFLPAENELREAIGRLGRFLANRR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagaaaaaaagtgtgcttttccagcaactattaccagttatcaaacagtatcag
caatcgggctttacccatgaaaaaattgttgaattacttaaagatcaacatgatctgaat
ttggtaacagtcaaaacatttaaaagttatttataccgatatgcaaaagtgaatccagct
atgtctaaaaatactgctactctccaatccatgccaacttcccgagaaattaaaaaatca
tcgaagcttgagcatgtttgttatgacattcgcggaccagtattacgagccgccaatgaa
atggaagagcaaggacataaaatcattaagctgaatatcggcaaccctgccccatttggt
tttgaagcaccacaagaaattattaatgacgttgctttaaacctaccaaatgcaattggt
tatgtagattcaaaaggtatctttccggcacgtaaagcaatctgccagtactaccagcaa
aaaggcatcttaaatatgcacgttaatgacgtgtatatcggtaatggtgtatctgaactc
attgtcatggctatgcaaggcctactcgatgatggtgatgaaatgctcattccgatgcct
gactatccgctttggacagctgccgttaacctgtcgggtggtacagccattcactataag
tgtgatgaagaaaacagttggtatcctgatattgccgatattgaaagtaaaattacttca
aacacacgtggtattgtcattatcaatccgaacaacccaactggttcggtatatccacgt
catgtgcttgagcaaattgtggcacttgcaaagaaacatgacctgattttatttgctgac
gaaatttacgacaaaatcgtttacgacggcattgaacatgttgctgttgcttctttagca
ggcgaccaattatgtatttctttcaatgggctatcaaaagcatatcgtattgctggtttc
cgttcaggctggatggcaatcacaggcgataagagccgtgcagcagactatatcgaaggt
ctggatatgttagcttcaatgcgtttatgtgcaaacgtacaagctcagtatgcaattcaa
acggcgcttggtggctatcagtctattaatgatttgatccgaccaggtggacgtttatat
gaacagcgtaatatcgcatgggaaatgttaaatgaaattcctggtgtaagctgtgttaaa
ccagaaggcgcaatgtattgtttcccgcgtcttgaccctaacatttacccaatcgaagat
gatgaaaagttaatgttagatttacttcgtgctgaaaaagtactattagttcaaggaaca
ggttttaactggccaacaccagaccatttccgtgttgttttcttaccggcagaaaacgaa
ttacgtgaagcaattggtcgtttaggtcgtttcttggccaatcgccgttaa

DBGET integrated database retrieval system