KEGG   Acinetobacter baumannii AB307-0294: ABBFA_000172Help
Entry
ABBFA_000172      CDS       T00795                                 

Gene name
acsA
Definition
acetate--CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABBFA_000172 (acsA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABBFA_000172 (acsA)
   00620 Pyruvate metabolism
    ABBFA_000172 (acsA)
   00640 Propanoate metabolism
    ABBFA_000172 (acsA)
  Energy metabolism
   00680 Methane metabolism
    ABBFA_000172 (acsA)
Enzymes [BR:abb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ABBFA_000172 (acsA)
Lipid biosynthesis proteins [BR:abb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ABBFA_000172 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
193420..195369
Genome map
AA seq 649 aa AA seqDB search
MNEIYPVPEEFKKTARTVEADYFKRYQHSIENPDEFWAEQAKIVDWIKPFTQVKNTSFDK
DNFKIEWFADGELNVSANCLDRHLKEHPHKPAIIWEGDHPSRHKIVSYKELHDEVCRFAN
VLKKYGIGKGDRVVLYMPMVTEAAIAMLACARIGAVHCVVFGGFSPDSLASRIEDSQAKL
VITADSSLRAGKLLPLKENVDLALALPGTECVENVIVVYRNANPIEMKPGRDLWYHLIIM
EVDANCPPEPMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYVASTFKEVFDLKQDDVYW
CTADVGWITGHSYLIYGPLANGTTTLMFEGVPQYPTWARLGHVVDKHKVSILYTAPTAIR
AMMREGDSYVRESNRSSLRLLGSVGEPINPEAWNWYYNVVGEGRCPIVDTWWQTETGGIL
IAPLPGATALKPGSATRPLFGIQPAIVDGEGNELEGAAEGNLVIKDSWPGQMRTIWGDPD
RFIEAYFSTFKNTYFTGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHESV
AEAAVVGMPHDIKGQGICTFVTLQAGVPESEELRKELISWVRKVLGPVASPDALHWAPAL
PKTRSGKIMRRILRKIAANELDSLGDTSTLAEPAVVDQLIATVYPDRQK
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagatctatccagtaccagaggaatttaaaaaaacagctcgtactgttgaagca
gactactttaaacgttatcaacactctatcgagaacccagatgaattctgggcagagcaa
gctaaaattgtcgattggataaagccatttacccaagttaaaaataccagttttgacaaa
gacaatttcaagattgaatggtttgctgatggtgagttgaacgtatcagcaaactgcttg
gacaggcatcttaaagaacaccctcacaaacctgcaattatttgggaaggtgaccatcct
tctcgtcataaaatcgtttcttataaagaattacacgacgaagtctgccgtttcgccaac
gttttaaagaaatatggcattggtaaaggtgaccgcgttgtgctgtatatgccaatggtg
actgaggctgcaattgccatgttagcctgtgcccgtattggtgcggtgcactgcgtggta
tttggtggtttctcaccagactcgttggcgagtcgtattgaagatagccaagctaaactt
gtgattacggctgactcaagcctacgtgccggtaagttgttaccacttaaagaaaatgtt
gatttggctctagcattgccgggcacagagtgcgttgaaaacgtgattgtggtttaccgt
aatgcaaacccaatcgagatgaagccgggtcgtgatttgtggtatcaccttattattatg
gaggtggatgcaaactgtcctccagaaccaatgaaggccgaagaccctttatttattctt
tatacctctggctcgacaggtaaacctaaaggagtgttgcatactacaggtggttatctg
gtgtatgtggcgagtacctttaaagaagtttttgatttaaaacaagatgatgtgtactgg
tgtaccgctgatgtcggctggattacaggccatagttatctaatctatggaccattggca
aatggtacgacgaccttaatgtttgaaggtgtgcctcagtatccaacatgggcacgtctt
ggtcatgtggtcgataaacataaagtctctattttatatacagcgccaaccgcgattcga
gccatgatgcgagaaggtgattcgtatgtacgtgaaagtaaccgtagtagtttgcgtttg
ttaggttcagtgggtgaacctattaaccctgaggcttggaactggtactacaatgttgtc
ggcgaaggccgctgcccgattgttgatacatggtggcaaaccgaaacaggtggtattttg
attgcgccattaccgggggcaacagctttaaaaccaggttcggcaacgcgacctttattt
ggtattcaaccagctattgtagatggtgaaggcaatgaactagaaggcgctgccgaaggt
aatcttgtgattaaagattcatggccgggccagatgcgtaccatttggggtgacccagat
cgctttattgaagcttacttctcgacctttaaaaatacttattttacaggtgatggcgcc
cgccgtgatgaagatggctattactggatcacgggtcgtgttgacgatgtcttaaacgtt
tcaggccaccgtctaggtacggctgaaattgaaagtgctcttgtatcgcatgaatcggtg
gcagaggctgctgttgtaggtatgccgcatgatattaaagggcagggtatttgtactttt
gtgactttgcaggcgggtgttccggagtcggaagaactgcgaaaagagttaattagctgg
gtacgtaaagtacttggaccagtggcttcaccagatgcactgcactgggcgccggcatta
cctaaaacccgttcgggtaaaatcatgcgccgtattttaagaaaaattgcagcgaatgaa
ctggatagtttgggcgatacctcaaccctagctgaaccggcagtggtggatcaactgatt
gcgacagtttatcctgatagacaaaaataa

DBGET integrated database retrieval system