KEGG   Acinetobacter baumannii AB307-0294: ABBFA_000314Help
Entry
ABBFA_000314      CDS       T00795                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ABBFA_000314
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABBFA_000314
Enzymes [BR:abb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     ABBFA_000314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
335421..336923
Genome map
AA seq 500 aa AA seqDB search
MTVSFQEIHPIEIDAQWPQQPFHGFSLDSRKVETGQIFIALTSYSQPEKTRTFFAEAALA
NGALAVISETELGVANEWVCPDVRQRMGEWQKRYLQQADVVKPLRIIAVTGTNGKTTISR
LIAELISSQQQRCAVMGTTGNGILPNLTPSTHTTLDALQLQNALHDYAKQGATFASLEAS
SHGLEQGRLNGCDIEIAVYSNLSRDHLDYHGTLEAYAEAKARLFQFNSLKVAVINLDDAH
ADLMIESAQNNPAQPKILTYSLTQNTADYYITDLNYSLAGATFNLVSQQGSFAVESPLLG
HFNVENLIAALIAAEQAGFDLQALVNFVPKLIGAPGRMQVIRDDERLFVVDYAHTPDALI
QVLKTLKRHVSNQLWAVFGCGGDRDRGKRPLMTQAALDGANPVILTSDNPRTEDPEQIFA
DMKQGIDFSGHRMHEIHDRREAIKFVAEQAQAGDIVVIAGKGHENYQEINGVRHWFDDVV
EVRSAIDAQHHTVDAAYPAQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgactgtttcttttcaagaaattcatccaatcgaaattgatgctcaatggcctcaacag
ccatttcacggctttagtttagatagtcgtaaagttgaaacgggccaaatttttattgct
ttgacaagttatagccagcctgaaaaaacgcgtacattttttgctgaagcggctttagca
aatggagcgttggctgttattagcgaaaccgaattaggtgtagcaaatgaatgggtatgc
cctgatgtgcgtcagcgcatgggagagtggcaaaaacgttatttgcaacaagctgatgta
gtaaaacctcttcggattattgctgtaacaggcacaaatggtaaaacaacaatttctcgt
ttaattgctgagttaattagttcacaacagcagcgctgtgcagtgatggggacaacaggg
aatggtattttacctaacttaacgccttctacgcatactaccctcgacgctctacagtta
caaaatgcactacatgattatgctaaacagggagcaacctttgcttctttagaagcaagt
tcacatggtcttgaacaaggtcgattaaacggttgcgatattgaaattgctgtttatagc
aacttaagtcgtgaccatctggattatcacggcactttagaagcttatgcagaagcgaag
gcgcgtttatttcagtttaattcgttaaaagtcgctgttattaatttagatgatgcgcat
gctgacttgatgattgagtccgcccaaaataatccagcacaacctaaaattttgacttac
tcactaactcaaaatacagctgattattatattaccgatttaaactatagcttggcgggt
gcaacttttaatttagtaagtcagcaaggttcatttgcggtagaaagcccattattaggt
catttcaatgttgaaaatttgattgccgcactcatcgctgctgagcaagctggtttcgat
ttacaggcattggttaattttgttcctaaactaattggtgcaccaggccgaatgcaagtt
attcgtgatgatgagcgattatttgtagtggattatgcgcatacaccagatgcattgatt
caagtgcttaaaacattaaagcgtcatgtttcgaatcagctttgggcggtgtttggatgt
ggtggtgaccgtgaccgtggtaagcgtccactcatgactcaagcagctttagatggcgca
aatcctgttattctgacttcagataatccaagaacagaagaccctgaacaaatttttgct
gacatgaagcaaggaatcgatttttcagggcatcgtatgcatgaaattcatgaccgccgt
gaagcaattaaatttgttgcagagcaagctcaagctggtgacattgtagtgattgccggc
aaaggacatgaaaattatcaagaaattaatggtgtgcgtcactggtttgatgatgtggtt
gaagtgcgttccgcgattgatgcccaacatcatacggtagacgctgcttaccctgcacaa
tag

DBGET integrated database retrieval system