KEGG   Acinetobacter baumannii AB307-0294: ABBFA_000581Help
Entry
ABBFA_000581      CDS       T00795                                 

Definition
stearoyl-CoA desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ABBFA_000581
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ABBFA_000581
Enzymes [BR:abb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     ABBFA_000581
Lipid biosynthesis proteins [BR:abb01004]
 Desaturase
  First
   ABBFA_000581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(610581..611753)
Genome map
AA seq 390 aa AA seqDB search
MTSAPLKAPINWTASITLIGLPILAAIIIPIYAYYYDFSVSAWVSLFFLLALSSMGITAG
YHRLWAHRAYEASLPLKILLMIGGTFAVQNSILFWASGHRTHHRHVDDVDEDPYSIERGF
WYAHMGWMIRDHSPSEPDFKNAPDLLNDKLVMFQHKYYALMVVAVHVGILGLVGWATGDL
WGVVLLGGLLRLIISHQVTFFINSLCHMFGKRPYTDENSARDNFWLAIATWGEGYHNYHH
IFQYDYRNGVKWWQYDPTKWLIWTCSKIGLAKNLRRIPSFNIKKAELAMKFKYAEQDLAI
YGHDVNADISQMKQRIAQEYEAFTHTLNDWAKLKEQELQAKKAAMAEKIHKMDHKLKVDF
QLLEHRLSHHRECLETLMRNIKKNTNVVPD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgccccactcaaggccccaattaactggaccgctagcattaccttaattggt
ttaccaattcttgctgcaatcataatcccgatttatgcgtattattatgattttagtgta
agcgcatgggtaagcttattttttcttttagctttaagtagcatggggattactgctggt
taccatcgtctttgggcacaccgtgcttatgaagcgtcgttaccacttaaaattctttta
atgattggcggcacatttgctgtacaaaacagtattctgttttgggcatctggtcaccgt
acccatcaccgtcatgtcgacgatgtagatgaagatccatattcaattgaacgtggcttt
tggtatgcccatatgggttggatgatccgcgatcattctccatctgaaccagattttaaa
aatgcaccagacttactcaatgacaaactggtgatgttccaacataaatactatgccttg
atggtcgtagcagttcacgttggtattttaggtttggttggctgggcaactggcgattta
tggggtgttgtacttcttggtggcctattacgtttaatcattagtcatcaagttacattc
ttcatcaactcactttgccacatgttcggtaaacgcccttataccgatgaaaactcagca
cgcgataacttctggttagcgattgcaacttggggtgagggttaccacaactatcaccat
attttccagtacgactatcgtaatggtgtgaaatggtggcaatatgatccaacaaaatgg
ctaatctggacatgctctaagattggtttagcaaagaacctacgtcgtattccaagcttt
aatattaaaaaagcagaattggcaatgaagtttaaatatgctgaacaagacttggctatt
tatggtcatgatgtaaatgccgacattagtcaaatgaagcaacgtattgctcaagagtat
gaagcatttacacatactttaaatgactgggcgaaactcaaagaacaagagttacaagca
aagaaagcagcaatggctgaaaagattcacaaaatggatcacaagttaaaagttgatttc
caattgcttgaacatcgtttgagtcatcaccgtgagtgtttagaaactttaatgcgtaac
attaaaaagaacacaaacgtcgtaccagactaa

DBGET integrated database retrieval system