KEGG   Acinetobacter baumannii AB307-0294: ABBFA_000637Help
Entry
ABBFA_000637      CDS       T00795                                 

Definition
Thiol:disulfide interchange protein dsbC precursor
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abb  Acinetobacter baumannii AB307-0294
Brite
Enzymes [BR:abb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ABBFA_000637
Secretion system [BR:abb02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ABBFA_000637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(669810..670520)
Genome map
AA seq 236 aa AA seqDB search
MKTKLATLMLSLAFFGSAHADVKTLEQNLKTNYPDLPVKGVYQSPVAGIYEVYTSGRIVY
TNQDAKYFFVGNLVDIKQQKNMTEERIAELGKIDVKSLPLNQAIKYVKGKGERTLYIFSD
PDCPYCQRLEQNMVGVDNVTVYIFLYPLTSLHPNAEKVSNQIWCSKNPSEAWTNYMLNRK
LPAASKSCTSPIQKNIALGQKLNIDGTPTLFLQDGQRISGVPSDAKQIEALLQSVK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaaacttgctacactcatgttgagtttggcttttttcggttctgctcatgct
gatgttaaaacacttgaacaaaatctgaagacaaattatccagacctccctgtaaaaggt
gtctatcagtcacctgtcgctggaatttatgaagtctatacaagtggccgtattgtttat
accaatcaagatgcaaaatacttttttgtaggcaatttagttgatatcaaacaacaaaaa
aatatgacagaagagcgaattgccgaattgggtaaaattgatgttaaaagtctcccatta
aatcaggcaattaaatacgtcaaaggtaaaggagagcgtactctttatattttcagtgac
cctgattgcccttactgtcagcgtctagaacaaaatatggttggagtggataacgtaacg
gtatatatattcttatatccactgaccagcttacatccaaatgctgaaaaggtttctaat
caaatctggtgctctaaaaacccttcagaagcttggacaaattatatgcttaaccgtaaa
ttgccagcggctagcaaaagctgtacaagtccaattcagaaaaatattgctttaggccag
aaattaaatatagatggcacaccaactctgttcttacaagatggtcaaagaatctctggt
gtaccaagtgatgcaaaacagattgaagcattattacagtcagtaaaataa

DBGET integrated database retrieval system