KEGG   Acinetobacter baumannii AB307-0294: ABBFA_000655Help
Entry
ABBFA_000655      CDS       T00795                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABBFA_000655 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    ABBFA_000655 (dapE)
Enzymes [BR:abb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ABBFA_000655 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(691875..693008)
Genome map
AA seq 377 aa AA seqDB search
MNHSDTLSLSLELLQQPSVTPIDHTCQTIMADRLAKVGFHIEPMRFGDVDNLWARRGTEG
PVFCFAGHTDVVPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFVAKH
PNHKGSIAFLITSDEEGPAVNGTVKVIETLEKRNEKITWCLVGEPSSTHKLGDIVKNGRR
GSLNAVLKVQGKQGHVAYPHLARNPIHEASPALAELCQTVWDNGNEYFPATSFQISNIHA
GTGATNVIPGALEVTFNFRYSTEVTAEQLKQRVHEILDKHGLQYEIVWNLSGLPFLTPVG
ELVNAAQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHD
LDPLTDIYEQILENLLA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaccactcagacactctctcgcttagcttagaacttttacaacagccttctgttacc
cctattgatcatacttgccaaactattatggctgaccgcttagctaaagttggcttccat
attgaacctatgcgctttggagatgtcgataatttatgggctcgacgtggaaccgaaggc
cctgtattttgttttgctggtcataccgacgtagtaccaacaggacgtttagacgcttgg
aattcagacccatttgcaccagaaattcgcgatggcaaattatatggtcgtggttcagca
gatatgaaaactgcattagctgcaatggtagttgcatctgaacgttttgtagcaaaacac
ccaaaccataaaggttcaattgcttttttaattacttcagatgaagaaggtcctgctgtt
aacggtaccgttaaagtcatcgaaacactggaaaagcgtaatgaaaaaattacttggtgt
ttggttggtgaaccatcaagtactcataaattaggtgatattgttaagaatggccgtcgt
ggttctcttaatgctgtattgaaggttcaaggcaaacaaggtcatgtagcttacccacac
ttggcacgtaatccaattcatgaagcatctccagcgttagctgagttgtgccaaacagtt
tgggacaatggcaatgagtatttccctgcaacttcattccagatttcaaatatccatgca
ggtactggcgcaaccaatgtaatccctggtgctttagaagttacttttaatttccgttat
tcaaccgaggttacagcagaacagcttaaacaacgtgttcatgaaattttagacaagcat
ggcttgcagtatgaaattgtctggaatttgtctggcttaccattcttaactccagtaggt
gaattagttaacgcagctcaaactgctattttaaatgtgactggtactgagactgagctt
tcaacaagtggtggtacatctgatggacgcttcattgctccaacaggtgcacaagtttta
gaactcggtgttctaaacgctactatccatcaaattaatgaacatgttgatgtacatgat
cttgatccattaactgatatttatgagcaaattttagagaacctacttgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system