KEGG   Acinetobacter baumannii AB307-0294: ABBFA_000759Help
Entry
ABBFA_000759      CDS       T00795                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABBFA_000759 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABBFA_000759 (sdhD)
   00650 Butanoate metabolism
    ABBFA_000759 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ABBFA_000759 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
793061..793426
Genome map
AA seq 121 aa AA seqDB search
MKSATGLTGSGSRDWFIQRVSAVVLAAYTVVLFGWILCKGGFDYQQWAGFMMTLPMKIFS
LLAILSLIAHAWIGMWQVFTDYVTTRQMGPSAKGLRLVLTTAVIIAVFVYAIWGIQIFWA
N
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgctacaggtttaacaggttcaggttctcgtgattggtttatccagcgtgta
agtgctgtggtattggcagcttatactgttgttctttttggttggatcctctgcaaaggc
ggatttgactatcaacaatgggctggcttcatgatgacattaccaatgaagattttctct
ttattggcaattttgtcgcttatcgcacacgcatggattggtatgtggcaggtttttact
gactatgtcactactcgtcaaatgggtccttcagcgaaaggtttacgccttgtactgact
acggctgtcattattgcagtgtttgtgtacgcaatctggggtatccagattttctgggcg
aattga

DBGET integrated database retrieval system