KEGG   Acinetobacter baumannii AB307-0294: ABBFA_000764Help
Entry
ABBFA_000764      CDS       T00795                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABBFA_000764 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABBFA_000764 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    ABBFA_000764 (sucB)
Enzymes [BR:abb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ABBFA_000764 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
799410..800606
Genome map
AA seq 398 aa AA seqDB search
MATEIKAPVFPESVADGTIATWHKKVGEPVSRDEVICDIETDKVVLEVVAPADGSLVAII
KGEGDTVLSDEVIAQFEAGAGAAAAAPAAVEQAVAQTQAGAAPVVERNEAVSDQAPAVRK
ALTESGIAASDVQGTGRGGRITKEDVANHQAKPAANVTPLSVAVGERIEKRVPMTRLRKR
VAERLLAATQETAMLTTFNEVNMKPIMELRKQYKDAFEKRHGARLGFMSFFVKAATEALK
RYPAVNASIDGDDIVYHGYYDIGVAVSSDRGLVVPVLRDTDRMSYAEVEAGIAAYAAKAR
DGKLSIEEMTGGTFTITNGGTFGSLLSTPILNQPQTGILGMHKIQERPMAVNGQVEILPM
MYLALSYDHRMIDGKEAVGFLVAIKELLEEPAKLILDL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaaattaaagcaccggtattcccagagtctgttgcagatggaaccatcgca
acttggcataaaaaggtgggtgaacctgtatcacgtgatgaagtaatctgtgatattgaa
accgacaaagttgttttagaagttgttgctcctgcagatggtagcttggttgcaatcatt
aaaggtgaaggcgatacagttctttctgacgaagttattgctcaattcgaagctggtgct
ggcgcagcggctgctgctcctgcggctgtagaacaagcagttgctcagactcaagctggt
gctgctcctgttgttgagcgtaatgaagctgtatctgatcaagctcctgcggtacgtaaa
gcgttaactgaatctggtattgctgcttctgacgtacaaggtactggtcgtggtggtcgt
atcactaaagaagatgttgcgaaccatcaagctaaaccagctgctaacgttactccatta
agcgttgctgttggcgagcgtatcgaaaaacgcgttccaatgactcgtttacgtaaacgt
gtagctgagcgtcttcttgcggctactcaagaaacagcaatgttaactacatttaacgaa
gttaacatgaagccaatcatggaattacgtaagcaatataaagatgctttcgaaaaacgt
catggtgctcgtttaggcttcatgtcattcttcgttaaagcagcaactgaagcgcttaaa
cgctacccagctgtaaatgcttcaattgatggcgatgatatcgtttatcacggttactat
gacatcggtgttgcagtatcttctgatcgtggtcttgttgtaccagtattacgtgatact
gaccgtatgagctatgcagaagttgaagcaggtattgctgcttacgctgctaaagcacgt
gatggtaaattatctatcgaagaaatgactggcggtactttcacaatcactaacggtggt
actttcggttcattactttcaactccaattttgaaccagccgcaaactggtatcttgggt
atgcataaaatccaagaacgtcctatggcggtaaatggtcaagttgaaatcttgccaatg
atgtacttagcgctttcttatgaccaccgtatgatcgatggtaaagaagctgtaggtttc
ttagtagcaatcaaagaattgttagaagaaccagctaaactcattcttgatctttaa

DBGET integrated database retrieval system