KEGG   Acinetobacter baumannii AB307-0294: ABBFA_000793Help
Entry
ABBFA_000793      CDS       T00795                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABBFA_000793 (folP)
Enzymes [BR:abb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ABBFA_000793 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
855500..856351
Genome map
AA seq 283 aa AA seqDB search
MQLISLPKQILQCGQLQLDLSQPHVMGILNVTPDSFSDGGKHNQLDQAVDHALSMIEQGA
TIIDIGGESTRPGASEVVVEEEVRRVVPVVEALSYHNVILSIDTSQPEVIRAAKAAGAHI
WNDVRALTRPNALKTAVELDIPVVIMHMRGEPTTMNQLDQYTDVTLDVMQELQQRIDEAL
AAGVKKHNIIVDPGFGFAKNAQQNLKLLKEFWKLNELGYPILSGLSRKRFIGEALQGVPA
DQRAVGSVTGHLLSIQQGASIVRAHDVKEMHEAILVWKAMQQA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcagttaatatctttaccaaagcagattttacagtgtggacagcttcaattagattta
tctcagccccatgttatgggtatcttaaatgtcactcctgattctttcagtgatggtggt
aaacataaccaattagaccaagcggttgatcatgcacttagtatgattgagcaaggcgcg
actattattgatattgggggggaatctacccgacctggtgcttcagaagttgtagtagaa
gaagaagtgcgtcgtgtggtacctgtggtcgaggctttatcttaccataacgttattttg
tcgatcgacacaagtcagccagaagttattcgcgcagcaaaagcagcaggggcacatatc
tggaatgatgtccgtgccttaacacgtcccaatgctttaaaaactgccgtagaattagat
atacctgtagtaattatgcatatgcgcggtgaaccaacgacaatgaatcagttggatcag
tacactgatgtaacactcgatgtgatgcaagagttgcaacagcgtattgatgaggctttg
gctgctggggtaaaaaagcacaatattattgttgatcctggatttggctttgcgaaaaat
gcccagcaaaatttaaaactattaaaagaattttggaaacttaatgaacttggttatcca
attttatccgggctttctcgtaaacgtttcataggtgaagctttacaaggtgttcctgca
gatcaacgtgctgtgggaagtgtaactgggcatttgcttagtattcagcagggagcatcc
attgtaagagcgcatgatgtaaaggaaatgcatgaagcaattttagtttggaaagctatg
cagcaagcctaa

DBGET integrated database retrieval system