KEGG   Acinetobacter baumannii AB307-0294: ABBFA_000797Help
Entry
ABBFA_000797      CDS       T00795                                 

Definition
Alkaline phosphatase D precursor(APaseD) (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABBFA_000797
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ABBFA_000797
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ABBFA_000797
Enzymes [BR:abb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ABBFA_000797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
857504..859267
Genome map
AA seq 587 aa AA seqDB search
MSEKISRRELIQKSLLGFGALSIPVAFTGCNDGSDDESPEIQADFLHGVASGDPLQDKVI
LWTRVTPTDSGVRLKVVWEISTDNQFKQNLKTGMVETSKTDDFTVKVDAAGLQADTVYYY
RFKFGNKVSPVGQTKTLPTSTNKVSFAVCSCSNYPAGYFYVYREMAKQNVDVIIHLGDYI
YEYGADGYATEDATKLGRNLPADNNKEIIKLDDYRKRYALYRQDKDLQAVHQRHPFIVIW
DDHELANDAWREGAENHQSNEGAFSDRKLAALQAYFEWMPIRPVSSTDHLNIYRQFNFGS
LVQLTMLDTRIIARDKQLAYTDYMTATGLDIAKFQADLTNPVRTLMGYTQRDWLVDKLKQ
STATWNVVGQQVLMSKMWIPAELLASLGQITSGGTSPEALAKMNAQITELVALKLRLQQN
DPTLTAQEKARIMTVVPYNLDAWDGYYAEREFVYDKLAEFNKKIIVLAGDTHNAWASYLY
SQKGKYVGVELATSSVSSPGLEKYLSIPLAQLQQFEFAFTTLIDELVYCNLNQRGYLLVT
LDQVQVHSEWRFVDSIKNTEYQIDSSRQNDIVLDLNLMPLKQGQKTA
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagaaaatttcacgccgagaattaattcaaaaaagtctactcggttttggggct
ttatctatacctgttgcttttacaggttgtaatgatggctcagatgatgaaagcccagaa
atacaagcagattttcttcatggtgtggcaagcggggacccactacaagataaagttatt
ttgtggacacgagtaacaccgacagactctggggtgcgcttaaaagttgtatgggaaatt
tcaaccgataatcagtttaaacaaaatttaaagacgggaatggttgaaacaagcaagact
gatgactttacagtgaaagttgatgcagctgggttacaagcagatacggtgtactactac
cgttttaaatttggtaataaagtttcaccggttgggcagacgaaaacattaccaacatcc
accaataaagtgagctttgcagtatgttcttgttctaactatcctgcgggttacttttat
gtttatcgtgaaatggcaaaacagaatgttgatgtcattattcacttgggtgactatatt
tatgaatatggggcagatggctatgcgacagaagatgcaaccaagttaggccgtaattta
cctgccgataataataaagaaattattaaattagatgattaccgcaaacgttatgcgctt
tatcgtcaagataaagatttgcaagcagttcatcagcgccatccttttattgtgatttgg
gatgaccatgagttggcaaatgatgcttggcgtgagggggcggaaaaccatcaaagtaat
gaaggggccttttcggaccgtaaattagctgccctacaggcctattttgaatggatgcca
attcgtccagtttctagtacagatcatttaaatatttatcgccagtttaactttggctct
cttgttcagttaaccatgctagatacgcgtattattgcgcgtgataagcagcttgcatat
acagactacatgacggctacaggcttggatattgctaagtttcaggcagatttaactaat
ccggtgcgtactttgatggggtatacgcaaagagattggttggttgataaattaaagcaa
tctacagcaacatggaatgtagtaggacagcaagtattaatgagtaaaatgtggattcca
gctgagttgttggcgtctttagggcaaattacttcaggaggaacttcgcctgaagcgctt
gccaagatgaatgcacaaattaccgagttggtcgctttaaaacttcgtttacaacaaaat
gatccgacattaacagcccaagaaaaagcaagaattatgacggttgtgccatataatctc
gatgcttgggatggttactatgctgagcgagagtttgtgtacgataaattggcagagttt
aataaaaagatcattgtgttagccggggatacacataatgcatgggcatcttatttatat
agccagaaagggaaatatgttggagttgaattagcgaccagctctgtatcgtctccaggt
ttggaaaaatatttaagtattccattggctcagcttcaacagtttgaatttgcatttact
acattaattgatgaattggtttattgtaatttaaatcaacgaggatatttgttggttact
ctagatcaggtgcaagttcattctgagtggagatttgtagattcaattaaaaataccgaa
tatcagatagattcaagccgacaaaacgatattgtattggatctaaatttgatgccgtta
aaacaaggtcaaaagacggcttaa

DBGET integrated database retrieval system