KEGG   Acinetobacter baumannii AB307-0294: ABBFA_000804Help
Entry
ABBFA_000804      CDS       T00795                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:abb00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
863714..865222
Genome map
AA seq 502 aa AA seqDB search
MSNCPKKYIVAFDQGTTSSRAIVLDHDANVVSIAQREFTQIYPQPGWVEHDPMEIWATQS
AVWVEALAQAGIKSEQVAAIGITNQRETTIVWDKKTGRPIYNAIVWQSRQTTEICNQLYK
AGWQEYIRKTTGLVIDPYFSATKIKWILDHVEGSRERAERGELLFGTVDTWLIWKLTNGA
VHVTDFTNASRTMLFDIEKLEWDEKLLQALDIPRAMLPEVRSSSEVYGYTHTISGQEVGI
PIAGIAGDQQAALFGQMCVESGQAKNTYGTGCFLLMNTGKKIVRSEHGLLTTIACGASGE
VNYALEGAVFNGGSCVQWLRDELKVIKNAKDSELYATRVKDNNGVYVVPAFTGLGAPYWD
PTARGAIFGLTRGASIEHIIRATLESIAFQTRDVLDAMQQDAEEELRTLRVDGGVTENNF
LMQFQADILTTPVERPIMKETTALGAAFLAGLATGFWQDLHELRNKSAIEKVFEPKMPSE
QAELIYKGWLKAVKRSQNWAED
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaattgcccgaaaaaatatattgtcgcttttgatcagggaacaacaagctcaaga
gcaattgttttagatcatgatgcgaacgttgtcagtattgctcaaagagaatttacccag
atttaccctcagccaggttgggttgagcatgatcctatggaaatttgggcaactcaaagt
gctgtatgggtcgaagcattggctcaagctggcataaagagtgaacaagttgcggcaatt
ggaattacaaaccaacgggaaaccactattgtctgggacaaaaaaacaggaagacctatt
tacaatgcgattgtttggcaaagccgacaaacaacggaaatatgcaatcaattgtataaa
gcaggttggcaagaatatatccgtaagactactggtttagtcattgatccatatttctcg
gccacaaaaattaaatggattttggatcatgttgaaggcagtcgtgagcgtgctgaacgg
ggagagttattattcggtacggtggacacctggctcatttggaaactaactaatggtgct
gttcatgtcactgattttaccaatgcatctcgaaccatgctgtttgatatcgaaaagctt
gagtgggatgaaaaacttttacaagctttagatattcctagagcaatgttgccagaggtt
cgtagttcatctgaggtttatggatatacacataccattagtggacaagaagtagggatc
ccaattgccggaatcgcgggtgatcagcaggctgcgctttttggtcaaatgtgtgttgag
tcgggacaggctaaaaatacctacggtactggctgttttctactcatgaatacgggtaaa
aagattgtccgttcagagcatgggttactcacaactattgcctgtggtgcgagtggtgag
gtgaattatgccttagagggtgccgtatttaacggtggttcttgcgtacagtggttacgc
gatgaattaaaggttattaagaatgctaaggattccgagctttatgcaacacgtgtaaag
gataataatggtgtatatgtagtacctgcttttaccggattaggagcaccgtattgggac
ccgacagctcgcggcgcaatttttggtctgacacgtggggctagtattgaacatattatc
cgcgcaactctagagtctattgcctttcaaactcgggatgttttagatgccatgcaacaa
gatgcagaggaagagcttcgtacactccgtgttgatggaggagtaacggaaaataatttc
ttgatgcaatttcaggccgatattttaacgacaccggtagagcgtccaataatgaaagaa
actacagcattgggtgcagctttcttagcagggttggccactggtttttggcaagatctt
catgagttaagaaataaatctgccatagaaaaggtttttgaaccgaaaatgccttctgaa
caagctgaactcatttataaaggttggctaaaagcagttaagcgtagtcaaaattgggca
gaggattga

DBGET integrated database retrieval system