KEGG   Acinetobacter baumannii AB307-0294: ABBFA_000949Help
Entry
ABBFA_000949      CDS       T00795                                 

Definition
(GenBank) Glutamate 5-kinase(Gamma-glutamyl kinase) (GK)
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00330  Arginine and proline metabolism
abb00332  Carbapenem biosynthesis
abb01100  Metabolic pathways
abb01130  Biosynthesis of antibiotics
abb01230  Biosynthesis of amino acids
Module
abb_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ABBFA_000949
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ABBFA_000949
Enzymes [BR:abb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ABBFA_000949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACJ57838
UniProt: B7GYV2
Position
1021467..1022600
Genome map
AA seq 377 aa AA seqDB search
MIEVVDGQRKLSECKRIVVKIGSSLLTANGQGLDLDAISHWAKQIADLHNAGHEIILVSS
GAVAEGMVRMKLASRPTDLPSLQACAAIGQMGLIHTWSSVLENHSIRTAQVLLTHDDLAD
RRRYLNSCDALQNLIDWRVIPVINENDTVSTDEIRFGDNDTLAAMVAGQVHADLLIILTD
QQGMFDSDPRHNPDAKLLSTVRAMDDVLFEMAGGGGVLGRGGMVTKVRAARLAAKSGCPT
LIASGESDNVLSRVMAGEMLGTLFTTDKDRMTAHQQWLAAHLQTAGRLVIDDGAVEAIKL
KHRSLLPVGVKTVEGHFDRGDVVECVDKQGKRVAVGRVNFSSRSAEIIKGLSSDKVYQVL
GEARSLEMIHRDHMAIY
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagtggtcgatgggcaacgtaagctcagtgagtgtaaacgaatcgttgttaaa
atcggatcatctttactcacggcaaatgggcagggtctagatctggacgctatttcgcat
tgggcgaaacagattgcagatttacacaatgctggacacgaaattattttagtgtcttca
ggagctgtggcagaaggtatggttcgtatgaagcttgcgagtcgacccaccgatctaccc
agtcttcaagcatgtgccgcaattgggcagatgggcctaattcatacttggtctagtgtg
cttgaaaatcatagtatccgaactgctcaggtgttgttaacacatgatgatttggcagac
cgccgtcgttacttaaattcatgtgatgcattgcagaacttgattgattggcgtgttatt
ccggtcattaatgaaaacgatactgtatctaccgatgagattcgttttggtgataacgat
acactagcagctatggttgctggtcaagtacatgctgatttattaattattttaacagat
cagcaaggtatgtttgattcagacccacgtcataatcctgatgcaaagttattatcaact
gtgcgtgctatggatgatgttttatttgaaatggctggtggtggcggtgtactcggacgt
ggtggcatggtcactaaagttcgtgctgcacgtttagctgccaagtcaggttgcccgaca
ttaattgctagtggtgaaagcgacaatgtgttgtcacgagtgatggctggtgagatgctg
ggtacattgtttacgactgataaagaccgtatgacagcgcatcagcaatggcttgctgca
catttacaaacagcgggtcgtcttgtaattgatgatggcgcagttgaagcgattaaattg
aaacatcgcagtttattgcctgttggggtaaaaactgttgaaggacattttgatcgtggt
gatgtggttgaatgtgtcgataaacaaggtaaacgtgttgcggttgggcgagtgaatttt
agctctcgttctgctgaaattattaaaggtctttcttcagacaaagtttaccaagtactt
ggtgaagcccgttcattagaaatgattcatcgtgatcatatggcaatttactaa

DBGET integrated database retrieval system