KEGG   Acinetobacter baumannii AB307-0294: ABBFA_001082Help
Entry
ABBFA_001082      CDS       T00795                                 

Definition
Indole-3-glycerol phosphate synthase(IGPS) (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:abb01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:abb00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1178161..1178688)
Genome map
AA seq 175 aa AA seqDB search
MTDVDFFQGADENIAIARNHCALPALRKDFLVDPYNVVEARALHADCILLIVACLSDQQL
EEMSKTAFEHQLDVLVEVHDEEELERALKLSEQCLLGVNNRNLKTFDVDLNTTIRLKKLL
PASRLLITESGIATPDDVRMMQEHDIHSFLVGESFMKQPRPDQAFTALFGQPQTV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgatgttgatttctttcagggtgcagatgaaaatattgcgattgcccgtaatcat
tgtgccctacctgctttacgtaaagactttttggtcgacccgtacaatgtagttgaagca
cgtgctttgcatgctgactgtattttattaattgttgcttgtttgtctgaccagcaactc
gaagaaatgtctaaaactgcgtttgagcatcaacttgatgtattggttgaagttcatgac
gaagaagagttagagcgtgccttaaagctttctgagcaatgtttattaggcgtaaataac
cgtaatttaaaaacctttgatgtagatttaaatactactattcggttgaaaaaattactt
ccggcctcacgtttattgatcactgaaagtggtattgcgacaccagatgatgtacgtatg
atgcaagagcatgatattcacagtttcttggttggcgaaagttttatgaaacaaccacgt
ccagatcaagcttttactgccctttttggacaacctcaaacggtttaa

DBGET integrated database retrieval system