KEGG   Acinetobacter baumannii AB307-0294: ABBFA_001253Help
Entry
ABBFA_001253      CDS       T00795                                 

Definition
delta-9 desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ABBFA_001253
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ABBFA_001253
Enzymes [BR:abb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     ABBFA_001253
Lipid biosynthesis proteins [BR:abb01004]
 Desaturase
  First
   ABBFA_001253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1349664..1350635
Genome map
AA seq 323 aa AA seqDB search
MSKFFLRWIDSWSDSENAQVGASSEYVIEKKIQWLRIIPFILLHIACLAAFWVGVSWFAV
IFMLGFYFLRMFAITAFFHRYLSHKTFQTSRIVQFIFVLIGTMSAQRGPLWWAAHHRYHH
HFTDTDQDPHSAKAGFWYSHVGWFLNEQNFATRKKVIKDWLKYPELIWLDRFSLPIVILT
ALAIYGLGSWLAQHFPELGTNGLQLLVWGFVISTVLLTHATLCINSLAHRYGSREFNTPD
DSRNNFLLSLITLGEGWHNNHHFYAGSVRQGFYWWQIDITFYVLKLMSLFGLVWGLKPVP
DKVYQYKKIKNLSIEKIENGEVL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattttttctgcgctggatcgatagctggtcagattcagaaaatgcgcaagtg
ggtgcttctagcgaatatgtcattgaaaagaaaattcaatggttaagaattattcctttt
attttattacatatcgcttgtttagctgcattttgggtgggcgtatcttggtttgctgtg
atcttcatgctggggttttattttcttcgcatgtttgcaattactgcttttttccaccgc
tatctttcgcataaaacttttcagacatcacgtattgttcaattcatttttgtactgatc
ggaaccatgagtgcgcagcgcggacctttatggtgggcagcccatcaccgttatcaccat
cactttaccgacaccgatcaggacccgcattcagcaaaagcaggcttttggtattcgcat
gtaggctggtttttaaatgagcaaaattttgctactcgaaaaaaagtcattaaagactgg
ttgaaatatccagagctgatttggctagaccgatttagtttgcctattgtgattttgacg
gccttagcaatttatggattaggttcatggcttgcacaacatttccctgagttgggcacc
aatggtttacagcttttagtgtggggatttgtgatttccactgttctattaacacatgca
accttgtgtattaattcactcgctcatcgttatggttcacgtgagtttaacaccccagat
gatagccgtaataacttcctactttctttaattaccttgggtgaaggatggcataacaat
catcacttttacgcaggcagtgtgcgtcaaggtttttattggtggcagatagatatcact
ttttatgtgctcaagctgatgtctttatttggtttagtgtggggcctaaagcccgtacca
gacaaggtttatcaatataaaaagattaaaaacctatcgatagaaaaaattgaaaacggt
gaagtgttatga

DBGET integrated database retrieval system