KEGG   Acinetobacter baumannii AB307-0294: ABBFA_001319Help
Entry
ABBFA_001319      CDS       T00795                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:abb01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:abb00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:abb00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:abb00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:abb00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1417553..1419196
Genome map
AA seq 547 aa AA seqDB search
MKTLAEAYQQFDLTRLIEEQLVGHPQAINAYVECCERYVGKNKTALIWEGKNGQAEHYTF
EQLAELSGKLANFFKAQGIQAGDCIAGLLPRTPELLITILAAWRIGAIYQPLFTAFEAKS
IDHRITTAQTKLIVTNDEQRPKLNTLNVPVIVTVHQTGLLSEHDFDFWQSLQRYSEQCEP
VNRSFDDDFLMMFTSGTTGLAKSVPVPLKAILAFKGYMTHAVDLREEDMFWNLADPGWAY
GLYYGITGPLSLGHGIIMDERSFNVDQAIELIKKYKVSNLTGSPTAFRMFFGFKEKFDPS
IKQHLRVVSSAGEPLTPEVVNWFKQDLEVNIFDQYGQTELGMVIANHHALEHPLKVGSAG
FAIPGHRFAVLDQNYQELPTGGVGILAMDSEQSPLMWFKGYGGNNRKAFVGKYYLTGDTV
TLNEHGGIDFVGRADDVITTSGYRVGPFDVESTLLECEAVLESAVIGKPDPERTEIVKAF
VVLKPAYQACETLKDKLQQYVRNRLSRHAYPKEIEFVDSLPKTTSGKIQRGLLKQQEIAK
MQQAYAS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttggcagaagcttatcagcaatttgatcttacaaggctcatcgaagagcaa
cttgttgggcatccccaagcaataaatgcttatgttgagtgctgtgagcgttatgtagga
aaaaataaaacagcgcttatctgggaaggaaaaaacgggcaggcagagcactatacgttc
gaacaacttgctgaactttctggaaaacttgctaacttctttaaagcacaaggaattcaa
gctggagattgtattgcaggacttctaccaagaacgcctgagttattaattacaattttg
gcagcatggcgtataggcgctatttatcagcctttatttactgcctttgaagcaaaatcg
attgatcaccgaattacgactgctcaaactaaattgattgtgaccaatgatgaacagcgc
cctaaactgaataccttgaatgttccggttattgtaactgttcatcaaacaggtctttta
tctgagcatgactttgatttttggcaatctttacaacgatattctgagcaatgtgagcca
gtaaatcgtagctttgatgatgactttttaatgatgtttacctcaggcacaactggactt
gcaaagtctgtacctgttccactaaaagcaattttagcatttaaaggttatatgacccat
gccgttgatttgcgtgaagaggatatgttctggaatctggcagatccgggctgggcatat
ggattgtattatggcattaccgggcctttaagcttgggtcatggcattattatggatgag
cgttcatttaatgtagatcaggcaatagaattaattaaaaaatataaagtaagtaattta
acaggatcgcctacagcatttcgcatgttctttggatttaaggaaaaatttgacccttca
attaaacaacatttacgcgtagtgagtagtgcaggtgagccattaactcctgaggttgtg
aattggtttaagcaggatttagaggtcaatatttttgatcaatatggccaaactgagcta
ggcatggtaattgcgaaccaccatgcgcttgagcatccattaaaagtaggttcagctggt
tttgcaattcctgggcatcgttttgcggtgttagaccaaaattatcaagaattgccaact
ggtggtgttggtattttggcgatggactcggagcaatcgccattaatgtggtttaaaggt
tatggtggcaataatcgcaaagcctttgttggtaagtattatttaacaggtgacacggtc
actttaaatgaacatgggggcattgattttgtggggcgtgctgacgatgtcattacaact
tcgggttatcgagttggaccatttgatgttgaaagtactttattagagtgtgaggccgta
ttggagtcagcagtaattggtaagccagatccggaacgaaccgaaatagtcaaagctttt
gtggtacttaagcctgcttatcaagcgtgtgaaacattaaaagataagttacagcaatat
gttcgtaaccgtttatctcgtcatgcttatccaaaagagattgagtttgtggacagtcta
ccgaaaaccacgagcggaaaaattcaaagaggactgttgaagcagcaagaaattgcaaaa
atgcagcaagcctacgcaagctaa

DBGET integrated database retrieval system