KEGG   Acinetobacter baumannii AB307-0294: ABBFA_001324Help
Entry
ABBFA_001324      CDS       T00795                                 

Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1422475..1422912
Genome map
AA seq 145 aa AA seqDB search
MNAPETIFALALASNLDADQHFTFAYTQLATLGKVQFSSVYQIPCRDGIGDDYWNSACLL
RSTLACEQIESFLKKLETDSGRVRPSHHISLDVDLIAWGSDLDHMQFNSKKLPLALDVKI
PLYELWHCESLKVDSPLYPVVNFKV
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcaccagaaacaatttttgcgctcgccctagcgagtaatttagacgcagatcag
cactttacttttgcctatacgcaattagcaactttggggaaagtgcagttttcatctgtt
tatcaaattccatgccgagatggtattggagatgattactggaattcagcatgtctatta
agaagtactttagcctgtgaacaaattgaatcttttctcaaaaaacttgagacagattct
ggacgtgttcgtccgtcgcatcatatttctttagatgtagatttgattgcatggggaagt
gatctcgaccatatgcaatttaattctaaaaaactacctttagcactcgatgtcaaaatc
cctttatatgagctttggcattgtgaaagtttaaaggttgatagtccgctttatccggtc
gtcaattttaaagtttaa

DBGET integrated database retrieval system