KEGG   Acinetobacter baumannii AB307-0294: ABBFA_001324Help
Entry
ABBFA_001324      CDS       T00795                                 

Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABBFA_001324
Enzymes [BR:abb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ABBFA_001324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1422475..1422912
Genome map
AA seq 145 aa AA seqDB search
MNAPETIFALALASNLDADQHFTFAYTQLATLGKVQFSSVYQIPCRDGIGDDYWNSACLL
RSTLACEQIESFLKKLETDSGRVRPSHHISLDVDLIAWGSDLDHMQFNSKKLPLALDVKI
PLYELWHCESLKVDSPLYPVVNFKV
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcaccagaaacaatttttgcgctcgccctagcgagtaatttagacgcagatcag
cactttacttttgcctatacgcaattagcaactttggggaaagtgcagttttcatctgtt
tatcaaattccatgccgagatggtattggagatgattactggaattcagcatgtctatta
agaagtactttagcctgtgaacaaattgaatcttttctcaaaaaacttgagacagattct
ggacgtgttcgtccgtcgcatcatatttctttagatgtagatttgattgcatggggaagt
gatctcgaccatatgcaatttaattctaaaaaactacctttagcactcgatgtcaaaatc
cctttatatgagctttggcattgtgaaagtttaaaggttgatagtccgctttatccggtc
gtcaattttaaagtttaa

DBGET integrated database retrieval system